ZNF521 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF521 Antibody [NBP1-84882] - Staining of human placenta shows nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF521 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFSSLAVLQIHLKTMH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF521
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF521 Protein (NBP1-84882PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF521 Antibody

  • EHZF
  • Evi3
  • LIP3
  • ZFP521
  • zinc finger protein 263
  • Zinc finger protein FPM315
  • Zinc finger protein with KRAB and SCAN domains 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13611
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57466
Species: Hu
Applications: ICC/IF
355-BM/CF
Species: Hu, Mu, Rt
H00010798-R02
Species: Hu
NB600-248
Species: Hu
Applications: WB, IP
NBP2-35213
Species: Hu
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB17791
Species: Hu, Mu
Applications: WB
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for ZNF521 Antibody (NBP1-84882) (0)

There are no publications for ZNF521 Antibody (NBP1-84882).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF521 Antibody (NBP1-84882) (0)

There are no reviews for ZNF521 Antibody (NBP1-84882). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF521 Antibody (NBP1-84882) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF521 Products

Bioinformatics Tool for ZNF521 Antibody (NBP1-84882)

Discover related pathways, diseases and genes to ZNF521 Antibody (NBP1-84882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF521 Antibody (NBP1-84882)

Discover more about diseases related to ZNF521 Antibody (NBP1-84882).
 

Pathways for ZNF521 Antibody (NBP1-84882)

View related products by pathway.

Blogs on ZNF521

There are no specific blogs for ZNF521, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF521 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF521