STK11IP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: STK11IP Antibody [NBP1-92451] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: STK11IP Antibody [NBP1-92451] - Staining of human kidney shows strong cytoplasmic positivity with a granular pattern.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STK11IP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STK11IP Antibody - BSA Free (NBP1-92451) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPTLQQLNHVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK11IP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  STK11IP Protein (NBP1-92451PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for STK11IP Antibody - BSA Free

• KIAA1898LKB1 interacting protein
• LIP1serine/threonine kinase 11-interacting protein
• LKB1-interacting protein 1
• LKB1IPserine/threonine-protein kinase 11-interacting protein
• serine/threonine kinase 11 interacting protein
• STK11IP1STK11 interacting protein

Background

Serine/threonine kinase 11-interacting protein (STK11IP) is a leucine-rich repeat containing protein found to interact with the STK11 serine/threonine kinase. STK11IP is implicated to regulate STK11 function by controlling its subcellular localization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK11IP