ZNF507 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF507 Antibody [NBP1-82932] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: ZNF507 Antibody [NBP1-82932] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF507 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVIVERLPSAEETLSQKRFLMNTEMEEGKDLSLTEAQIGREGMDDVYRADKCTVDIGGLIIGWSSSEKKDELMNKGLATDENAPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF507
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF507 Protein (NBP1-82932PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF507 Antibody

  • BMZF-1ZNF411
  • Bone marrow zinc finger 1
  • DNA-binding protein
  • FLJ90391
  • zinc finger protein 253
  • Zinc finger protein 411BMZF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055777-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PP-B0422-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
AF4910
Species: Hu, Mu, Rt
Applications: WB
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-60417
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83619
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-58275
Species: Hu
Applications: WB, ICC/IF
NBP1-84717
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32157
Species: Hu
Applications: WB, IHC-P, IP
NBP2-43681
Species: Hu
Applications: WB, IP
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-82932
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF507 Antibody (NBP1-82932) (0)

There are no publications for ZNF507 Antibody (NBP1-82932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF507 Antibody (NBP1-82932) (0)

There are no reviews for ZNF507 Antibody (NBP1-82932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF507 Antibody (NBP1-82932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF507 Products

Bioinformatics Tool for ZNF507 Antibody (NBP1-82932)

Discover related pathways, diseases and genes to ZNF507 Antibody (NBP1-82932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF507 Antibody (NBP1-82932)

Discover more about diseases related to ZNF507 Antibody (NBP1-82932).

Blogs on ZNF507

There are no specific blogs for ZNF507, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF507 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF507