ZNF41 Antibody (4E9.)

Images

 
Western Blot: ZNF41 Antibody (4E9) [H00007592-M01] - Analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M01), clone 4E9.Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4E9.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF41 Antibody (4E9.) Summary

Immunogen
ZNF41 (NP_009061, 221 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSV*
Specificity
ZNF41 - zinc finger protein 41
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF41
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF41 Antibody (4E9.)

  • zinc finger protein 296
  • Zinc finger protein 342ZFP296ZNF342

Background

This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP2-46538
Species: Hu
Applications: WB, IHC
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85703
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5158
Species: Hu
Applications: WB, IHC
NBP1-93452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007592-M01
Species: Hu
Applications: WB, ELISA

Publications for ZNF41 Antibody (H00007592-M01) (0)

There are no publications for ZNF41 Antibody (H00007592-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF41 Antibody (H00007592-M01) (0)

There are no reviews for ZNF41 Antibody (H00007592-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF41 Antibody (H00007592-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF41 Products

Bioinformatics Tool for ZNF41 Antibody (H00007592-M01)

Discover related pathways, diseases and genes to ZNF41 Antibody (H00007592-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF41 Antibody (H00007592-M01)

Discover more about diseases related to ZNF41 Antibody (H00007592-M01).
 

Pathways for ZNF41 Antibody (H00007592-M01)

View related products by pathway.

Blogs on ZNF41

There are no specific blogs for ZNF41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF41 Antibody (4E9.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF41
Entrez
OMIM
Uniprot