ZNF384 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTA |
Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZNF384 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ZNF384 Antibody
Background
The ZNF384 gene contains long CAG trinucleotide repeats coding consecutive glutamine residues. The gene product may functionsas a transcription factor, with a potential role in the regulation of neurodevelopment or neuroplasticity. The proteinappears to bind an
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Publications for ZNF384 Antibody (NBP1-86675) (0)
There are no publications for ZNF384 Antibody (NBP1-86675).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF384 Antibody (NBP1-86675) (0)
There are no reviews for ZNF384 Antibody (NBP1-86675).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF384 Antibody (NBP1-86675) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF384 Products
Bioinformatics Tool for ZNF384 Antibody (NBP1-86675)
Discover related pathways, diseases and genes to ZNF384 Antibody (NBP1-86675). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ZNF384 Antibody (NBP1-86675)
Discover more about diseases related to ZNF384 Antibody (NBP1-86675).
| | Pathways for ZNF384 Antibody (NBP1-86675)
View related products by pathway.
|
PTMs for ZNF384 Antibody (NBP1-86675)
Learn more about PTMs related to ZNF384 Antibody (NBP1-86675).
|
Blogs on ZNF384