ZNF365 Antibody (2E3) - Azide and BSA Free

Western Blot: ZNF365 Antibody (2E3) [H00022891-M03] - Analysis of ZNF365 expression in transfected 293T cell line by ZNF365 monoclonal antibody (M03), clone 2E3. Lane 1: ZNF365 transfected lysate (Predicted MW: 31.4 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: ZNF365 Antibody (2E3) [H00022891-M03] - Detection limit for recombinant GST tagged ZNF365 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF365 Antibody (2E3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZNF365 Antibody (2E3) - Azide and BSA Free (H00022891-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZNF365 (NP_055766, 147 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALN
• Specificity: ZNF365 - zinc finger protein 365 (2E3)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZNF365
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF365 Antibody (2E3) - Azide and BSA Free

• DKFZp547M223
• double-stranded RNA-binding zinc finger protein JAZ
• JAZZfp346
• Just another zinc finger protein
• zinc finger protein 346

Background

ZNF365 may play a role in uric acid excretion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF365
• Entrez:
  • 22891(Human)
• Uniprot:
  • NP_055766(Human)