ZNF35 Antibody


Western Blot: ZNF35 Antibody [NBP2-30842] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: ZNF35 Antibody [NBP2-30842] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF35 Antibody [NBP2-30842] - Staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ZNF35 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQEAPAASTLGSYSLPGTLAKSEILETHGTMNFLGA
Specificity of human ZNF35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF35 Protein (NBP2-30842PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF35 Antibody

  • BRF2
  • Butyrate response factor 2
  • ERF2ERF-2
  • Protein TIS11D
  • RNF162Czinc finger protein 36, C3H1 type-like 2
  • TIS11DEGF-response factor 2
  • zinc finger protein 36, C3H type-like 1
  • zinc finger protein 36, C3H type-like 2
  • zinc finger protein, C3H type, 36-like 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF

Publications for ZNF35 Antibody (NBP2-30842) (0)

There are no publications for ZNF35 Antibody (NBP2-30842).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF35 Antibody (NBP2-30842) (0)

There are no reviews for ZNF35 Antibody (NBP2-30842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF35 Antibody (NBP2-30842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF35 Products

Bioinformatics Tool for ZNF35 Antibody (NBP2-30842)

Discover related pathways, diseases and genes to ZNF35 Antibody (NBP2-30842). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF35 Antibody (NBP2-30842)

Discover more about diseases related to ZNF35 Antibody (NBP2-30842).

Pathways for ZNF35 Antibody (NBP2-30842)

View related products by pathway.

Blogs on ZNF35

There are no specific blogs for ZNF35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF35 Antibody and receive a gift card or discount.


Gene Symbol ZNF35