ZNF343 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF343 Antibody [NBP2-57101] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF343 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CSSCLLAFSCQQFLSQHVLQIFLGLCAENHFHPGNSSPGHWKQQGQQYSHVSCWFENAEGQERGGGSKPWSAR
Specificity
Specificity of human ZNF343 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF343
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF343 Recombinant Protein Antigen (NBP2-57101PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF343 Antibody

  • FLJ3472
  • KOX21zinc finger protein 37a (KOX 21)
  • zinc finger protein 37A
  • Zinc finger protein KOX21
  • ZNF37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7895
Species: Hu
Applications: WB, IHC
NB100-2564
Species: Hu
Applications: WB
H00004653-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP, RNAi, S-ELISA
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-86240
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-81880
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
MAB2327
Species: Hu
Applications: WB, IP
NBP1-86503
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3454
Species: Mu
Applications: WB, IP
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-76827
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1146
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-57101
Species: Hu
Applications: ICC/IF

Publications for ZNF343 Antibody (NBP2-57101) (0)

There are no publications for ZNF343 Antibody (NBP2-57101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF343 Antibody (NBP2-57101) (0)

There are no reviews for ZNF343 Antibody (NBP2-57101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF343 Antibody (NBP2-57101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF343 Products

Bioinformatics Tool for ZNF343 Antibody (NBP2-57101)

Discover related pathways, diseases and genes to ZNF343 Antibody (NBP2-57101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF343 Antibody (NBP2-57101)

Discover more about diseases related to ZNF343 Antibody (NBP2-57101).
 

Pathways for ZNF343 Antibody (NBP2-57101)

View related products by pathway.

Blogs on ZNF343

There are no specific blogs for ZNF343, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF343 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF343