![Immunocytochemistry/Immunofluorescence: ZNF326 Antibody [NBP1-83658] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.](http://images.novusbio.com/fullsize/ZNF326-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83658-img0003.jpg "Immunocytochemistry/Immunofluorescence: ZNF326 Antibody [NBP1-83658] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RNYDAFGGPSTGRGRGRGHMGDFGSIHRPGIVVDYQNKSTNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF326 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF326 |
![Immunohistochemistry-Paraffin: ZNF326 Antibody [NBP1-83658] - Staining of human gall bladder shows strong nuclear and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ZNF326-Antibody-Immunohistochemistry-Paraffin-NBP1-83658-img0001.jpg "Immunohistochemistry-Paraffin: ZNF326 Antibody [NBP1-83658] - Staining of human gall bladder shows strong nuclear and cytoplasmic positivity in glandular cells.")
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/Follistatin_DFN00_ELISA_97.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_681.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_682.jpg)
![SEC-MALS IL-23A/IL-23 P19 [Unconjugated]](https://images.novusbio.com/images/1290-il_recombinant-human-il-23-protein-sec-mals-1012202411154..jpg)
![Western Blot LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12543.jpg)
![Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12613.jpg)
![Neutralization Siglec-7/CD328 Antibody [Unconjugated]](https://images.novusbio.com/images2/Siglec-7_AF1138_Block_Neutralize_8760.jpg)
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/TNF_RII_DRT200_ELISA_176.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_817.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_818.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")