ZNF274 Antibody

Images

 
Western Blot: ZNF274 Antibody [NBP1-80597] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-659
Immunohistochemistry-Paraffin: ZNF274 Antibody [NBP1-80597] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF274 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGHLVSVGWETTLENKELAPNSDIPEEEPAPSLKVQESSRDCALSSTLEDTLQGGVQEVQDTVLKQMESAQEKDLPQKKHFDNRESQANSGALDTNQVSLQKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMK
Specificity
Specificity of human ZNF274 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF274
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
ZNF274 Protein (NBP1-80597PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF274 Antibody

  • GIOT2
  • GIOT-2
  • gonadotropin inducible transcription repressor-2
  • Gonadotropin-inducible ovary transcription repressor 2
  • gonadotropin-inducible transcription repressor 2
  • KOX7DKFZp434F1811
  • zinc finger protein 44 (KOX 7)
  • zinc finger protein 44
  • Zinc finger protein 55DKFZp686L21136
  • Zinc finger protein 58ZNF504
  • Zinc finger protein KOX7
  • zinc finger protein ZnFP12
  • ZNF
  • ZNF55
  • ZNF58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48848
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-79451
Species: Hu
Applications: WB
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00008131-M02
Species: Hu, Rt
Applications: WB, ELISA
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC

Publications for ZNF274 Antibody (NBP1-80597) (0)

There are no publications for ZNF274 Antibody (NBP1-80597).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF274 Antibody (NBP1-80597) (0)

There are no reviews for ZNF274 Antibody (NBP1-80597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF274 Antibody (NBP1-80597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF274 Antibody (NBP1-80597)

Discover related pathways, diseases and genes to ZNF274 Antibody (NBP1-80597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF274 Antibody (NBP1-80597)

Discover more about diseases related to ZNF274 Antibody (NBP1-80597).
 

Pathways for ZNF274 Antibody (NBP1-80597)

View related products by pathway.

Blogs on ZNF274

There are no specific blogs for ZNF274, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF274 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF274