ZNF44 Antibody (4E2)

Images

 
Western Blot: ZNF44 Antibody (4E2) [H00051710-M01] - analysis of ZNF44 expression in transfected 293T cell line by ZNF44 monoclonal antibody (M01), clone 4E2. Lane 1: ZNF44 transfected lysate (17.5 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: ZNF44 Antibody (4E2) [H00051710-M01] - Analysis of monoclonal antibody to ZNF44 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.
Sandwich ELISA: ZNF44 Antibody (4E2) [H00051710-M01] - Detection limit for recombinant GST tagged ZNF44 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
4E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF44 Antibody (4E2) Summary

Immunogen
ZNF44 (NP_057348.2, 1 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQ
Specificity
ZNF44 - zinc finger protein 44 (KOX 7) (4E2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF44
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF44 Antibody (4E2)

  • DKFZp686K08243
  • KRAB zinc finger protein HFB101
  • ZF2
  • zinc finger protein 274FLJ37843
  • Zinc finger protein HFB101
  • Zinc finger protein with KRAB and SCAN domains 19
  • Zinc finger protein zfp2
  • ZKSCAN19HFB101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94521
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82866
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-79449
Species: Hu
Applications: WB
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01245
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4798
Species: Hu, Mu
Applications: WB
NBP1-81739
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP1-82013
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007702-M01
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP2-20961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051710-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for ZNF44 Antibody (H00051710-M01) (0)

There are no publications for ZNF44 Antibody (H00051710-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF44 Antibody (H00051710-M01) (0)

There are no reviews for ZNF44 Antibody (H00051710-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF44 Antibody (H00051710-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF44 Products

Bioinformatics Tool for ZNF44 Antibody (H00051710-M01)

Discover related pathways, diseases and genes to ZNF44 Antibody (H00051710-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF44 Antibody (H00051710-M01)

Discover more about diseases related to ZNF44 Antibody (H00051710-M01).
 

Pathways for ZNF44 Antibody (H00051710-M01)

View related products by pathway.

Blogs on ZNF44

There are no specific blogs for ZNF44, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF44 Antibody (4E2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF44
Entrez
Uniprot