ZNF236 Antibody

Images

 
Western Blot: ZNF236 Antibody [NBP2-83838] - WB Suggested Anti-ZNF236 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysateZNF236 is supported by BioGPS gene expression data to be ...read more
Immunohistochemistry-Paraffin: ZNF236 Antibody [NBP2-83838] - Rabbit Anti-ZNF236 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Nuclear in hepatocytes, moderate signal, moderate ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF236 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF236. Peptide sequence: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF236
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF236 Antibody

  • regulated by glucose
  • zinc finger protein 236
  • ZNF236A
  • ZNF236B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6168
Species: Hu, Pm, Pm
Applications: Flow (-), Flow, ICC/IF (-), ICC/IF, IHC, IHC-P, IP (-), IP, WB (-), WB
NBP1-90217
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87377
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03633
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-373
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP2-34852
Species: Hu, Mu
Applications: IP, WB
AF2460
Species: Hu
Applications: IP, Neut, WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NB100-56732
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
NBP1-93685
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49284
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2498
Species: Mu
Applications: IP, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-83939
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82679
Species: Hu
Applications: IHC, IHC-P, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-89443
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89270
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83838
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZNF236 Antibody (NBP2-83838) (0)

There are no publications for ZNF236 Antibody (NBP2-83838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF236 Antibody (NBP2-83838) (0)

There are no reviews for ZNF236 Antibody (NBP2-83838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF236 Antibody (NBP2-83838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF236 Products

Bioinformatics Tool for ZNF236 Antibody (NBP2-83838)

Discover related pathways, diseases and genes to ZNF236 Antibody (NBP2-83838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF236 Antibody (NBP2-83838)

Discover more about diseases related to ZNF236 Antibody (NBP2-83838).

Blogs on ZNF236

There are no specific blogs for ZNF236, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF236 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF236