ZNF516 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF516 Antibody [NBP1-93685] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZNF516 Antibody [NBP1-93685] - Staining of human prostate shows granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF516 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CCFSEEVTSTELSSGDQSHKMGDNASERDTGESKAGIAASVSILENSSRETSRRQEQHRFSMDLKMPAFHPKQEVPVPGDGVEFPSSTGAEGQTGHPAEKLSDLH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF516
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 31336144).
Control Peptide
ZNF516 Protein (NBP1-93685PEP)
Publications
Read Publication using
NBP1-93685 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31336144).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF516 Antibody

  • HsT287
  • KIAA0222
  • zinc finger protein 516

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87377
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-34852
Species: Hu, Mu
Applications: IP, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-35006
Species: Hu
Applications: Func, PAGE
NBP1-76550
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-69078
Species: Mu
Applications: WB
NBP2-56581
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS6168
Species: Hu, Pm, Pm
Applications: Flow (-), Flow, ICC/IF (-), ICC/IF, IHC, IHC-P, IP (-), IP, WB (-), WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-14842
Species: Bv, Ca, Hu, Po, Pm, Rb
Applications: WB
NB100-56405
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-82679
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-83838
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20199
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-77092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-93685
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ZNF516 Antibody (NBP1-93685)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ZNF516 Antibody (NBP1-93685) (0)

There are no reviews for ZNF516 Antibody (NBP1-93685). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF516 Antibody (NBP1-93685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF516 Products

Bioinformatics Tool for ZNF516 Antibody (NBP1-93685)

Discover related pathways, diseases and genes to ZNF516 Antibody (NBP1-93685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF516 Antibody (NBP1-93685)

Discover more about diseases related to ZNF516 Antibody (NBP1-93685).

Blogs on ZNF516

There are no specific blogs for ZNF516, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF516 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF516