ZNF207 Antibody

Images

 
Genetic Strategies: Western Blot: ZNF207 Antibody [NBP1-89550] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ZNF207 antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: ZNF207 Antibody [NBP1-89550] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF207 Antibody [NBP1-89550] - Staining of human testis.
Western Blot: ZNF207 Antibody [NBP1-89550] - Analysis in human cell line HEK 293.
Western Blot: ZNF207 Antibody [NBP1-89550] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ZNF207 Antibody [NBP1-89550] - Staining of human kidney shows strong nuclear positivity in tubular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: ZNF207 Antibody [NBP1-89550] - Staining of human colon, kidney, lymph node and testis using Anti-ZNF207 antibody NBP1-89550 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: ZNF207 Antibody [NBP1-89550] - Staining of human colon.
Immunohistochemistry-Paraffin: ZNF207 Antibody [NBP1-89550] - Staining of human lymph node.
Immunohistochemistry-Paraffin: ZNF207 Antibody [NBP1-89550] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF207 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
Specificity
Specificity of human, mouse, rat ZNF207 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF207
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-89550 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25918225).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF207 Antibody

  • DKFZp761N202
  • zinc finger protein 207

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-58200
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Ye, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-65899
Species: Hu
NBP1-55043
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-30659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85817
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-46214
Species: Hu
Applications: WB, IHC
NBP1-89550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for ZNF207 Antibody (NBP1-89550)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ZNF207 Antibody (NBP1-89550) (0)

There are no reviews for ZNF207 Antibody (NBP1-89550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF207 Antibody (NBP1-89550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF207 Products

Bioinformatics Tool for ZNF207 Antibody (NBP1-89550)

Discover related pathways, diseases and genes to ZNF207 Antibody (NBP1-89550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF207

There are no specific blogs for ZNF207, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF207 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF207