ZNF167 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF167. Source: E.coli Amino Acid Sequence: MMESSELTPKQEIFKGSESSNSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKK |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ZNF167 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-57863 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here. |
| Theoretical MW |
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for ZNF167 Recombinant Protein Antigen
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: AC
Publications for ZNF167 Recombinant Protein Antigen (NBP2-57863PEP) (0)
There are no publications for ZNF167 Recombinant Protein Antigen (NBP2-57863PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF167 Recombinant Protein Antigen (NBP2-57863PEP) (0)
There are no reviews for ZNF167 Recombinant Protein Antigen (NBP2-57863PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ZNF167 Recombinant Protein Antigen (NBP2-57863PEP) (0)
Other Available Formats
Additional ZNF167 Products
Bioinformatics Tool for ZNF167 Recombinant Protein Antigen (NBP2-57863PEP)
Discover related pathways, diseases and genes to ZNF167 Recombinant Protein Antigen (NBP2-57863PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Blogs on ZNF167
![Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/Histatin-3-Antibody-(4G9)-Immunocytochemistry-Immunofluorescence-H00003347-M01-img0005.jpg)
![Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/images2/Histatin-3-Antibody-(4G9)-Sandwich-ELISA-H00003347-M01-img0006.jpg)
![Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.](http://images.novusbio.com/images/DAND5 Antibody (2H3)-Western Blot-NBP2-01223-img0002.jpg)
![Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.](http://images.novusbio.com/images/DAND5 Antibody (2H3)-Immunohistochemistry-Paraffin-NBP2-01223-img0005.jpg)
![Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images/DAND5 Antibody (2H3)-Flow Cytometry-NBP2-01223-img0001.jpg)
![Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.](http://images.novusbio.com/images2/SP1-Antibody-Western-Blot-NB600-233-img0007.jpg)
![Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB](http://images.novusbio.com/images2/SP1-Antibody-Immunohistochemistry-Paraffin-NB600-233-img0009.jpg)
![Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.](http://images.novusbio.com/images2/SP1-Antibody-Chromatin-Immunoprecipitation-NB600-233-img0014.jpg)
![Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Western-Blot-H00001958-M03-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Immunocytochemistry-Immunofluorescence-H00001958-M03-img0010.jpg)
![Immunohistochemistry-Paraffin: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Immunohistochemistry-Paraffin-H00001958-M03-img0011.jpg)
![Western Blot: Zhangfei Antibody [NBP1-76539] - K562 cell lysate with ZHANGFEI antibody at 1 ug/mL.](http://images.novusbio.com/images2/Zhangfei-Antibody-Western-Blot-NBP1-76539-img0001.jpg)
![Immunocytochemistry: Zhangfei Antibody [NBP1-76539] - Immunocytochemistry of ZHANGFEI in K562 cells with ZHANGFEI antibody at 10 ug/mL.](http://images.novusbio.com/images2/Zhangfei-Antibody-Immunocytochemistry-NBP1-76539-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: GTF3A Antibody [NBP1-89064] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/GTF3A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89064-img0004.jpg)
![Immunohistochemistry-Paraffin: GTF3A Antibody [NBP1-89064] - Staining of human lymphoid tissues shows moderate nuclear positivity in lymphoid cells.](http://images.novusbio.com/images2/GTF3A-Antibody-Immunohistochemistry-Paraffin-NBP1-89064-img0007.jpg)
![Immunohistochemistry-Paraffin: GTF3A Antibody [NBP1-89064] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.](http://images.novusbio.com/images2/GTF3A-Antibody-Immunohistochemistry-Paraffin-NBP1-89064-img0001.jpg)
![Western Blot: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of Huntingtin on A431 cell using anti-Huntingtin antibody at 1/500 dilution.](http://images.novusbio.com/images2/Huntingtin Antibody (JB89-34)-Western Blot-NBP2-75531-img0006.jpg)
![Immunohistochemistry-Paraffin: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of paraffin-embedded rat brain tissue using anti-Huntingtin antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Huntingtin-Antibody-(JB89-34)-Immunohistochemistry-Paraffin-NBP2-75531-img0005.jpg)
![Flow Cytometry: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of SH-SY-5Y cells with Huntingtin antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.](http://images.novusbio.com/images2/Huntingtin-Antibody-(JB89-34)-Flow-Cytometry-NBP2-75531-img0001.jpg)
![Western Blot: KAP1 [p Ser824] Antibody [NB100-2350] - MDA-MB-231 cells were treated with DMSO or Merbarone (100 uM) for 24 hours, whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. KAP1 [p Ser824] Antibody (NB100-2350) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.](http://images.novusbio.com/images2/KAP1-[p-Ser824]-Antibody-Western-Blot-NB100-2350-img0019.jpg)
![Immunocytochemistry/Immunofluorescence: KAP1 [p Ser824] Antibody [NB100-2350] - NBF-fixed asynchronous HeLa cells grown in chambered microscope slides and treated with EPE (left) or untreated (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight (R) 594 conjugated used at a dilution of 1:100.](http://images.novusbio.com/images2/KAP1-[p-Ser824]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-2350-img0015.jpg)
![Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - Human Phospho Kap1 (S824) by Immunohistochemistry. Sample: FFPE serial section of human lung cancer used at a dilution of 1:200 (1 ug/ml). Detection: DAB](http://images.novusbio.com/images2/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0014.jpg)
![Western Blot: ZNF96 Antibody [NBP1-88018] - Analysis in control (vector only transfected HEK293T lysate) and ZSCAN12 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/ZNF96 Antibody-Western Blot-NBP1-88018-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: ZNF96 Antibody [NBP1-88018] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubules.](http://images.novusbio.com/images2/ZNF96-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88018-img0006.jpg)
![Immunohistochemistry-Paraffin: ZNF96 Antibody [NBP1-88018] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells, Glial cells displayed weak staining.](http://images.novusbio.com/images2/ZNF96-Antibody-Immunohistochemistry-Paraffin-NBP1-88018-img0002.jpg)
![Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.](http://images.novusbio.com/images2/c-jun-Antibody-(5B1)-Western-Blot-NBP2-37576-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/images2/c-jun-Antibody-(5B1)-Immunocytochemistry-Immunofluorescence-NBP2-37576-img0004.jpg)
![Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.](http://images.novusbio.com/images2/c-jun-Antibody-(5B1)-Immunohistochemistry-NBP2-37576-img0007.jpg)
![Western Blot: Ctip1 Antibody [NB600-261] - Whole cell lysate (50 ug) from L1210, TCMK-1, and 4T1 cells. Antibodies: Affinity purified rabbit anti-Bcl11a antibody used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/Ctip1-Antibody-Western-Blot-NB600-261-img0003.jpg)
![Western Blot: Ctip1 Antibody [NB600-261] - Detection of human Ctip1 (Bcl11a) by western blot. Samples: Whole cell lysate from Ramos (15 and 50 ug), HEK293T (T; 50 ug) and Jurkat (J; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Ctip1 antibody NB600-261 used at 1 ug/ml. Detection: Chemiluminescence with exposure times of 30 seconds.](http://images.novusbio.com/images2/Ctip1-Antibody-Western-Blot-NB600-261-img0001.jpg)
![Immunoprecipitation: Ctip1 Antibody [NB600-261] - Detection of human Ctip1 (Bcl11a) by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from Ramos cells. Antibodies: Affinity purified rabbit anti-Ctip1 antibody NB600-261 used for IP at 6 ul/mg lysate. Ctip1 was also immunoprecipitated by a rabbit anti-Ctip1 antibodies (NB600-258, NB600-259) and rabbit anti-Ctip1 recombinant monoclonal antibody [BLR073G] (NBP2-78710). For blotting immunoprecipitated Ctip1, NBP2-78710 was used at 1:1000. Chemiluminescence with an exposure time of 75 seconds.](http://images.novusbio.com/images2/Ctip1-Antibody-Immunoprecipitation-NB600-261-img0002.jpg)
![Immunohistochemistry-Paraffin: EpCAM/TROP1 Antibody (AUA1) [NB600-1182] - Analysis of a FFPE human breast carcinoma tissue section using 1:100 dilution of EpCAM/TROP1 antibody (clone AUA1) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This EpCAM antibody generated an expected immunostaining of EpCAM (CD326) protein in the membranes of the cancer cells and the inter-cellular spaces. The tumor stroma and the stromal cells did not show EpCAM immunopositivity.](http://images.novusbio.com/images2/EpCAM-TROP1-Antibody-(AUA1)-Immunohistochemistry-Paraffin-NB600-1182-img0009.jpg)
![Western Blot: EpCAM/TROP1 Antibody (AUA1) [NB600-1182] - Detection of EpCAM/CD326 in two Human mammary tumor cell lines, MDA-MB-231 (mesenchyme-like) and MCF-7 (epithelium-like). Dilution: 1:500 in PBS with 5% BSA. Secondary Ab: anti-Mouse IgG 1:5,000. This image was submitted via customer Review.](http://images.novusbio.com/images2/EpCAM-TROP1-Antibody-(AUA1)-Western-Blot-NB600-1182-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: EpCAM/TROP1 Antibody (AUA1) [NB600-1182] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-EpCAM/TROP1 (AUA1) conjugated to Alexa Fluor 488 [NB600-1182AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/EpCAM-TROP1-Antibody-(AUA1)-Immunocytochemistry-Immunofluorescence-NB600-1182-img0016.jpg)