ZNF96 Antibody

Images

 
Western Blot: ZNF96 Antibody [NBP1-88018] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ZNF96 Antibody [NBP1-88018] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: ZNF96 Antibody [NBP1-88018] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells, Glial cells displayed weak staining.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF96 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IIHTGEKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZSCAN12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF96 Protein (NBP1-88018PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF96 Antibody

  • KIAA0426dJ29K1.2
  • ZFP96
  • zinc finger and SCAN domain containing 12
  • Zinc finger protein 305ZNF305
  • Zinc finger protein 96ZNF96zinc finger and SCAN domain-containing protein 12
  • ZNF29K1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13555
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1566
Species: Hu
Applications: WB, IP
NBP2-56768
Species: Hu
Applications: ICC/IF
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83927
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF96 Antibody (NBP1-88018) (0)

There are no publications for ZNF96 Antibody (NBP1-88018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF96 Antibody (NBP1-88018) (0)

There are no reviews for ZNF96 Antibody (NBP1-88018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF96 Antibody (NBP1-88018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF96 Products

Bioinformatics Tool for ZNF96 Antibody (NBP1-88018)

Discover related pathways, diseases and genes to ZNF96 Antibody (NBP1-88018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF96 Antibody (NBP1-88018)

Discover more about diseases related to ZNF96 Antibody (NBP1-88018).
 

Pathways for ZNF96 Antibody (NBP1-88018)

View related products by pathway.

Blogs on ZNF96

There are no specific blogs for ZNF96, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF96 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSCAN12