Recombinant Human ZNF167 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF167 Protein Summary

Description
ZNF167 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMM
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF167

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF167 Protein

  • FLJ12738
  • ZFP
  • zinc finger protein 167
  • Zinc finger protein 448Zinc finger protein with KRAB and SCAN domains 7
  • Zinc finger protein 64ZNF448
  • ZKSCAN7ZNF64

Background

ZNF167 - zinc finger protein 167

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
AF1107
Species: Mu
Applications: WB, IHC
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-88018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for ZNF167 Partial Recombinant Protein (H00055888-Q01) (0)

There are no publications for ZNF167 Partial Recombinant Protein (H00055888-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF167 Partial Recombinant Protein (H00055888-Q01) (0)

There are no reviews for ZNF167 Partial Recombinant Protein (H00055888-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF167 Partial Recombinant Protein (H00055888-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF167 Products

Bioinformatics Tool for ZNF167 Partial Recombinant Protein (H00055888-Q01)

Discover related pathways, diseases and genes to ZNF167 Partial Recombinant Protein (H00055888-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF167

There are no specific blogs for ZNF167, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF167 Antibody
NBP2-13555
ZNF167 Antibody
NBP2-13555
ZNF167 Antibody
NBP2-13555
GDNF [Unconjugated]
212-GD-010/CF
GDNF [Unconjugated]
212-GD-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF167 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF167