Recombinant Human ZNF167 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF167 Protein Summary

Description
ZNF167 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMM
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF167

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF167 Protein

  • FLJ12738
  • ZFP
  • zinc finger protein 167
  • Zinc finger protein 448Zinc finger protein with KRAB and SCAN domains 7
  • Zinc finger protein 64ZNF448
  • ZKSCAN7ZNF64

Background

ZNF167 - zinc finger protein 167

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB6799
Species: Hu
Applications: WB, IHC
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2818
Species: Hu
Applications: WB, ICC
NBP1-83299
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-88018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
MAB8998
Species: Mu
Applications: Flow, CyTOF-reported
H00055888-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF167 Partial Recombinant Protein (H00055888-Q01) (0)

There are no publications for ZNF167 Partial Recombinant Protein (H00055888-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF167 Partial Recombinant Protein (H00055888-Q01) (0)

There are no reviews for ZNF167 Partial Recombinant Protein (H00055888-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF167 Partial Recombinant Protein (H00055888-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human ZNF167 Protein Products

Related Products by Gene

Bioinformatics Tool for ZNF167 Partial Recombinant Protein (H00055888-Q01)

Discover related pathways, diseases and genes to ZNF167 Partial Recombinant Protein (H00055888-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF167

There are no specific blogs for ZNF167, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human ZNF167 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF167

Customers Who Bought This Also Bought

ZNF167 Antibody
NBP2-13555
ZNF167 Antibody
NBP2-13555