ZIP4H/Tex11 Antibody - BSA Free

Western Blot: ZIP4H/Tex11 Antibody [NBP2-88635] - Host: Rabbit. Target Name: TEX11. Sample Tissue: Human OVCAR-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZIP4H/Tex11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZIP4H/Tex11 Antibody - BSA Free (NBP2-88635) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZIP4H/Tex11. Peptide sequence: MLAKVLRLLATNYLDWDDTKYYDKALNAVNLANKEHLSSPGLFLKMKILL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEX11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZIP4H/Tex11 Antibody - BSA Free

• testis expressed 11
• testis expressed sequence 11
• testis-expressed sequence 11 protein
• Tex11
• TGC1
• TSGA3
• ZIP4H

Background

The TEX11 gene is X-linked and is expressed in only male germ cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEX11