CUZD1 Antibody - BSA Free

Analysis in human pancreas and liver tissues using NBP2-49558 antibody. Corresponding CUZD1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CUZD1 Antibody [NBP2-49558] - Staining of human cerebral cortex, lymph node, pancreas and testis using Anti-CUZD1 antibody NBP2-49558 (A) shows similar protein distribution across tissues to independent antibody NBP2-49561 (B).

Immunohistochemistry-Paraffin: CUZD1 Antibody [NBP2-49558] - Staining of human pancreas shows high expression.

Staining of human kidney shows no positivity in cells in tubules as expected.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CUZD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QVSLRASDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRSMSSVYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CUZD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CUZD1 Recombinant Protein Antigen (NBP2-49558PEP)

Reactivity Notes

Mouse (83%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CUZD1 Antibody - BSA Free

• CUB and zona pellucida-like domain-containing protein 1
• CUB and zona pellucida-like domains 1
• CUB and ZP domain-containing protein 1
• ERG-1
• estrogen regulated gene 1
• Transmembrane protein UO-44
• UO-44

Background

CUZD1, also known as CUB and zona pellucida-like domain-containing protein 1, contains a 68 kDa, 37 kDa, and 27 kDa isoform, and is involved in preventing the attachment and proliferation of ovarian cancer cells, and may also affect the uterus during the final stages of pregnancy. Researchers are currently conducting experiments to determine the relationship between CUZD1 and diseases such as ovarian cancer and pancreatitis. The protein interacts with PTPN6, and is linked to cell migration, cell proliferation, and the hormone-mediated signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CUZD1