TAF7L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAF7L Antibody [NBP1-84350] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TAF7L Antibody [NBP1-84350] - Staining of human testis shows cytoplasmic and nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF7L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF7L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF7L Protein (NBP1-84350PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF7L Antibody

  • 50kDa
  • CT40FLJ23157
  • RNA polymerase II TBP-associated factor subunit Q
  • TAF2QRNA polymerase II, Q
  • TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, Q
  • TATA box-binding protein-associated factor 50 kDa
  • transcription initiation factor TFIID subunit 7-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20830
Species: Hu
Applications: WB, ICC/IF
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5627
Species: Mu
Applications: WB
NBP1-86525
Species: Hu
Applications: IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TAF7L Antibody (NBP1-84350) (0)

There are no publications for TAF7L Antibody (NBP1-84350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF7L Antibody (NBP1-84350) (0)

There are no reviews for TAF7L Antibody (NBP1-84350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAF7L Antibody (NBP1-84350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF7L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF7L