ZFHX4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZFHX4 Antibody [NBP1-82156] - Staining of human cell line A549 shows localization to nucleoplasm & nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZFHX4 Antibody [NBP1-82156] - Staining of human small intestine shows distinct nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFHX4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESKDQENNCERPKESNVLHPNGECPVKSEPTEPGDEDEEDAYSNELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTEKKKQTAAVRASGSVASNYGISGKDFADA
Localization
Nucleus
Specificity
Specificity of human ZFHX4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFHX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFHX4 Protein (NBP1-82156PEP)
Publications
Read Publication using NBP1-82156.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFHX4 Antibody

  • FLJ16514
  • FLJ20980
  • ZFH-4
  • ZFH4ZHF4
  • zinc finger homeobox 4
  • zinc finger homeobox protein 4
  • zinc finger homeodomain 4
  • Zinc finger homeodomain protein 4
  • zinc-finger homeodomain protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7384
Species: Hu
Applications: ICC
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-66402
Species: Hu
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21005
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28740
Species: Hu
Applications: WB, IP
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-81185
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7619
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-82156
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZFHX4 Antibody (NBP1-82156)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for ZFHX4 Antibody (NBP1-82156) (0)

There are no reviews for ZFHX4 Antibody (NBP1-82156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZFHX4 Antibody (NBP1-82156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZFHX4 Antibody (NBP1-82156)

Discover related pathways, diseases and genes to ZFHX4 Antibody (NBP1-82156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFHX4 Antibody (NBP1-82156)

Discover more about diseases related to ZFHX4 Antibody (NBP1-82156).
 

Pathways for ZFHX4 Antibody (NBP1-82156)

View related products by pathway.

PTMs for ZFHX4 Antibody (NBP1-82156)

Learn more about PTMs related to ZFHX4 Antibody (NBP1-82156).

Blogs on ZFHX4

There are no specific blogs for ZFHX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFHX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFHX4
Entrez
Uniprot