ZEB1 Recombinant Protein Antigen

Images

 
There are currently no images for ZEB1 Protein (NBP1-88845PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZEB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZEB1.

Source: E. coli

Amino Acid Sequence: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZEB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88845.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZEB1 Recombinant Protein Antigen

  • AREB6
  • AREB6MGC133261
  • BZP
  • delta-crystallin enhancer binding factor 1
  • DELTAEF1
  • FECD6
  • Negative regulator of IL2
  • NIL-2-A zinc finger protein
  • NIL2A
  • NIL-2-A
  • posterior polymorphous corneal dystrophy 3
  • PPCD3
  • TCF8
  • TCF-8
  • TCF8BZP
  • transcription factor 8 (represses interleukin 2 expression)
  • Transcription factor 8
  • ZEB
  • ZEB1
  • ZFHEP
  • ZFHX1A
  • zinc finger E-box binding homeobox 1
  • zinc finger E-box-binding homeobox 1
  • zinc finger homeodomain enhancer-binding protein

Background

ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-55266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
H00001296-M01-100ug
Species: Hu
Applications: ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00001487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-88845PEP
Species: Hu
Applications: AC

Publications for ZEB1 Protein (NBP1-88845PEP) (0)

There are no publications for ZEB1 Protein (NBP1-88845PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZEB1 Protein (NBP1-88845PEP) (0)

There are no reviews for ZEB1 Protein (NBP1-88845PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZEB1 Protein (NBP1-88845PEP). (Showing 1 - 1 of 1 FAQ).

  1. In looking at the Zeb1 antibodies on your website, the molecular weights of Zeb1 detected by several antibodies are different. Why is this?
    • ZEB1 is a rather large protein and undergoes a lot of post translational modifications such as phosphorylation and glycosylation (please see: UniProt P37275). The reason band patterns are different in the images may be due to sample type and how highly modified the ZEB1 protein is that the antibody is detecting. The more post translational modifications the higher you will detect the protein.

Additional ZEB1 Products

Research Areas for ZEB1 Protein (NBP1-88845PEP)

Find related products by research area.

Blogs on ZEB1.

Nickel induces migratory and invasive phenotype in human epithelial cells by epigenetically activating ZEB1
By Jamshed Arslan Pharm.D. Nickel (Ni) is a naturally abundant metallic element. It is a major component of stainless steel, coins, and many other items of daily use. Disturbingly, Ni exposure is associated with can...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Understanding the relationship between HIF-1 alpha, Hypoxia and Epithelial-Mesenchymal Transition
Epithelial-mesenchymal transition (EMT) is a natural process by which epithelial cells lose their polarity and intercellular adhesion, and gain the migratory invasive properties of mesenchymal stem cells that can differentiate into a variety of cel...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZEB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZEB1