Recombinant Human ZEB1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ZEB1 Protein [H00006935-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human ZEB1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 801-900 of Human ZEB1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ZEB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZEB1 GST (N-Term) Protein

  • AREB6
  • AREB6MGC133261
  • BZP
  • delta-crystallin enhancer binding factor 1
  • DELTAEF1
  • FECD6
  • Negative regulator of IL2
  • NIL-2-A zinc finger protein
  • NIL2A
  • NIL-2-A
  • posterior polymorphous corneal dystrophy 3
  • PPCD3
  • TCF8
  • TCF-8
  • TCF8BZP
  • transcription factor 8 (represses interleukin 2 expression)
  • Transcription factor 8
  • ZEB
  • ZEB1
  • ZFHEP
  • ZFHX1A
  • zinc finger E-box binding homeobox 1
  • zinc finger E-box-binding homeobox 1
  • zinc finger homeodomain enhancer-binding protein

Background

TCF8 - transcription factor 8 (represses interleukin 2 expression)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-55266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001296-M01-100ug
Species: Hu
Applications: ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00001487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
H00006935-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for ZEB1 Partial Recombinant Protein (H00006935-Q01) (0)

There are no publications for ZEB1 Partial Recombinant Protein (H00006935-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZEB1 Partial Recombinant Protein (H00006935-Q01) (0)

There are no reviews for ZEB1 Partial Recombinant Protein (H00006935-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZEB1 Partial Recombinant Protein (H00006935-Q01). (Showing 1 - 1 of 1 FAQ).

  1. In looking at the Zeb1 antibodies on your website, the molecular weights of Zeb1 detected by several antibodies are different. Why is this?
    • ZEB1 is a rather large protein and undergoes a lot of post translational modifications such as phosphorylation and glycosylation (please see: UniProt P37275). The reason band patterns are different in the images may be due to sample type and how highly modified the ZEB1 protein is that the antibody is detecting. The more post translational modifications the higher you will detect the protein.

Additional ZEB1 Products

Research Areas for ZEB1 Partial Recombinant Protein (H00006935-Q01)

Find related products by research area.

Blogs on ZEB1.

Nickel induces migratory and invasive phenotype in human epithelial cells by epigenetically activating ZEB1
By Jamshed Arslan Pharm.D. Nickel (Ni) is a naturally abundant metallic element. It is a major component of stainless steel, coins, and many other items of daily use. Disturbingly, Ni exposure is associated with can...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Understanding the relationship between HIF-1 alpha, Hypoxia and Epithelial-Mesenchymal Transition
Epithelial-mesenchymal transition (EMT) is a natural process by which epithelial cells lose their polarity and intercellular adhesion, and gain the migratory invasive properties of mesenchymal stem cells that can differentiate into a variety of cel...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZEB1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZEB1