Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC |
Clone | 4C4 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | ZEB1 (NP_110378, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE |
Marker | Mesenchymal Cells Marker |
Specificity | transcription factor 8 (represses interleukin 2 expression) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | ZEB1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Diseases for ZEB1 Antibody (H00006935-M01)Discover more about diseases related to ZEB1 Antibody (H00006935-M01).
| Pathways for ZEB1 Antibody (H00006935-M01)View related products by pathway.
|
PTMs for ZEB1 Antibody (H00006935-M01)Learn more about PTMs related to ZEB1 Antibody (H00006935-M01).
| Research Areas for ZEB1 Antibody (H00006935-M01)Find related products by research area.
|
Nickel induces migratory and invasive phenotype in human epithelial cells by epigenetically activating ZEB1 By Jamshed Arslan Pharm.D. Nickel (Ni) is a naturally abundant metallic element. It is a major component of stainless steel, coins, and many other items of daily use. Disturbingly, Ni exposure is associated with can... Read full blog post. |
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post. |
Understanding the relationship between HIF-1 alpha, Hypoxia and Epithelial-Mesenchymal Transition Epithelial-mesenchymal transition (EMT) is a natural process by which epithelial cells lose their polarity and intercellular adhesion, and gain the migratory invasive properties of mesenchymal stem cells that can differentiate into a variety of cel... Read full blog post. |
CD63: is it pro-metastatic or anti-metastatic? CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,... Read full blog post. |
Beta Catenin in Cell Adhesion and T-cell Signaling Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.