ZDHHC17 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human ZDHHC17 (NP_056151.2).
Sequence: TSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKEFRQKVMLGTP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZDHHC17 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
73 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for ZDHHC17 Antibody - BSA Free
Background
ZDHHC17 / HIP14 is a neuronal palmitoyl transferase. Palmitoylation is critical for trafficking and function of signaling molecules, neurotransmitter receptors, and synaptic scaffolding proteins in neurons. ZDHHC17 also causes cellular transformation. It has been shown that mRNA encoding ZDHHC17 is up-regulated in a number of types of human tumors, thus ZDHHC17 and other PATs (palmitoyl acyltransferases) are potential targets for new anticancer drugs.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for ZDHHC17 Antibody (NBP3-38335) (0)
There are no publications for ZDHHC17 Antibody (NBP3-38335).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZDHHC17 Antibody (NBP3-38335) (0)
There are no reviews for ZDHHC17 Antibody (NBP3-38335).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZDHHC17 Antibody (NBP3-38335) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZDHHC17 Products
Research Areas for ZDHHC17 Antibody (NBP3-38335)
Find related products by research area.
|
Blogs on ZDHHC17