Recombinant Human ZCCHV GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZCCHV GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 601-699 of Human ZCCHV

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZC3HAV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZCCHV GST (N-Term) Protein

  • FLB6421DKFZp686O19171
  • FLJ13288antiviral 1
  • ZAPDKFZp686F2052
  • ZC3HDC2DKFZp686H1869
  • Zinc finger antiviral protein
  • Zinc finger CCCH domain-containing protein 2
  • zinc finger CCCH-type antiviral protein 1
  • zinc finger CCCH-type, antiviral 1

Background

This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60490
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
MAB3648
Species: Hu
Applications: CyTOF-ready, Flow, Neut
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
7268-CT
Species: Hu
Applications: BA
MAB7500
Species: Hu
Applications: ICC, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56473
Species: Hu, Mu, Pm
Applications: Simple Western, WB
2037-C5/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
202-IL
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF7116
Species: Hu
Applications: WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for ZCCHV Partial Recombinant Protein (H00056829-Q01) (0)

There are no publications for ZCCHV Partial Recombinant Protein (H00056829-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCCHV Partial Recombinant Protein (H00056829-Q01) (0)

There are no reviews for ZCCHV Partial Recombinant Protein (H00056829-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZCCHV Partial Recombinant Protein (H00056829-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZCCHV Products

Bioinformatics Tool for ZCCHV Partial Recombinant Protein (H00056829-Q01)

Discover related pathways, diseases and genes to ZCCHV Partial Recombinant Protein (H00056829-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZCCHV Partial Recombinant Protein (H00056829-Q01)

Discover more about diseases related to ZCCHV Partial Recombinant Protein (H00056829-Q01).
 

Pathways for ZCCHV Partial Recombinant Protein (H00056829-Q01)

View related products by pathway.

Blogs on ZCCHV

There are no specific blogs for ZCCHV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZCCHV GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3HAV1