![Western Blot: ZCCHC8 Antibody [NBP1-85134] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/ZCCHC8-Antibody-Western-Blot-NBP1-85134-img0008.jpg "Western Blot: ZCCHC8 Antibody [NBP1-85134] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, Rt, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QYHQEIEEFVSNLVKRFEEQQKNDVEKTSFNLLPQPSSIVLEEDHKVEESCAIKNNKEAFSVVGSVLYFTNFCLDKLGQPLLNENPQLSEGWEIPKYH |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZCCHC8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZCCHC8 |
![Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/ZCCHC8-Antibody-Immunohistochemistry-NBP1-85134-img0004.jpg "Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Western Blot: ZCCHC8 Antibody [NBP1-85134] - Analysis in human testis tissue.](http://images.novusbio.com/fullsize/ZCCHC8-Antibody-Western-Blot-NBP1-85134-img0007.jpg "Western Blot: ZCCHC8 Antibody [NBP1-85134] - Analysis in human testis tissue.")
![Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ZCCHC8-Antibody-Immunohistochemistry-NBP1-85134-img0001.jpg "Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ZCCHC8-Antibody-Immunohistochemistry-NBP1-85134-img0002.jpg "Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human Fallopian tube shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ZCCHC8-Antibody-Immunohistochemistry-NBP1-85134-img0003.jpg "Immunohistochemistry: ZCCHC8 Antibody [NBP1-85134] - Immunohistochemical staining of human Fallopian tube shows moderate to strong nuclear positivity in glandular cells.")
![Immunofluorescence: ZCCHC8 Antibody [NBP1-85134] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/ZCCHC8-Antibody-Immunofluorescence-NBP1-85134-img0006.jpg "Immunofluorescence: ZCCHC8 Antibody [NBP1-85134] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
![DR3/TNFRSF25 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "DR3/TNFRSF25 [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")