Recombinant Human ZCCHC6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZCCHC6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-412 of Human ZCCHC6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAVGIAIDKVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFPAIMSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQRSHFFKLFIY

Protein/Peptide Type
Recombinant Protein
Gene
ZCCHC6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZCCHC6 Protein

  • DKFZp666B142
  • DKFZp686C11112
  • DKFZp686F119
  • DKFZp686I1269
  • EC 2.7.7.52
  • FLJ13409
  • HS2
  • KIAA1711
  • PAP associated domain containing 6
  • PAPD6
  • terminal uridylyltransferase 7
  • TUT7
  • TUTase 7
  • Zinc finger CCHC domain-containing protein 6
  • zinc finger, CCHC domain containing 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NB100-2070
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5789
Species: Hu, Mu, Rt
Applications: WB
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43557
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-83027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079670-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZCCHC6 Recombinant Protein (H00079670-P01) (0)

There are no publications for ZCCHC6 Recombinant Protein (H00079670-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCCHC6 Recombinant Protein (H00079670-P01) (0)

There are no reviews for ZCCHC6 Recombinant Protein (H00079670-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZCCHC6 Recombinant Protein (H00079670-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZCCHC6 Products

Bioinformatics Tool for ZCCHC6 Recombinant Protein (H00079670-P01)

Discover related pathways, diseases and genes to ZCCHC6 Recombinant Protein (H00079670-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZCCHC6 Recombinant Protein (H00079670-P01)

Discover more about diseases related to ZCCHC6 Recombinant Protein (H00079670-P01).
 

Pathways for ZCCHC6 Recombinant Protein (H00079670-P01)

View related products by pathway.

PTMs for ZCCHC6 Recombinant Protein (H00079670-P01)

Learn more about PTMs related to ZCCHC6 Recombinant Protein (H00079670-P01).

Blogs on ZCCHC6

There are no specific blogs for ZCCHC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

14-3-3 Antibody
NBP2-27202
ZCCHC6 Antibody
NBP1-82257

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZCCHC6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZCCHC6