ZCCHC17 Antibody


Western Blot: ZCCHC17 Antibody [NBP1-57131] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZCCHC17 Antibody Summary

Synthetic peptides corresponding to ZCCHC17(zinc finger, CCHC domain containing 17) The peptide sequence was selected from the middle region of ZCCHC17. Peptide sequence CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ZCCHC17 and was validated on Western blot.
ZCCHC17 Lysate (NBP2-65087)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZCCHC17 Antibody

  • HSPC251
  • nucleolar protein of 40 kDa
  • Pnn-interacting nucleolar protein
  • pNO40nucleolar protein 40
  • PS1D protein
  • PS1DRP11-266K22.1
  • putative S1 RNA binding domain protein
  • Putative S1 RNA-binding domain protein
  • Zinc finger CCHC domain-containing protein 17
  • zinc finger, CCHC domain containing 17


ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain. The exact function of ZDHHC19 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZCCHC17 Antibody (NBP1-57131) (0)

There are no publications for ZCCHC17 Antibody (NBP1-57131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCCHC17 Antibody (NBP1-57131) (0)

There are no reviews for ZCCHC17 Antibody (NBP1-57131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZCCHC17 Antibody (NBP1-57131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZCCHC17 Antibody (NBP1-57131)

Discover related pathways, diseases and genes to ZCCHC17 Antibody (NBP1-57131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZCCHC17 Antibody (NBP1-57131)

View related products by pathway.

Blogs on ZCCHC17

There are no specific blogs for ZCCHC17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZCCHC17 Antibody and receive a gift card or discount.


Gene Symbol ZCCHC17