Home » ARL6IP4 » ARL6IP4 Research Products » ARL6IP4 Antibody (5E5)

ARL6IP4 Antibody (5E5)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ARL6IP4 Antibody (5E5) [H00051329-M09] - Analysis of ARL6IP4 expression in Hela S3 NE (Cat # L013V3).
Western Blot: ARL6IP4 Antibody (5E5) [H00051329-M09] - Analysis of ARL6IP4 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: ARL6IP4 Antibody (5E5) [H00051329-M09] - Analysis of monoclonal antibody to ARL6IP4 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: ARL6IP4 Antibody (5E5) [H00051329-M09] - Analysis of monoclonal antibody to ARL6IP4 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Sandwich ELISA: ARL6IP4 Antibody (5E5) [H00051329-M09] - Detection limit for recombinant GST tagged ARL6IP4 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, PmSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
5E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARL6IP4 Antibody (5E5) Summary

Immunogen
ARL6IP4 (NP_061164, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
Specificity
ARL6IP4 - ADP-ribosylation-like factor 6 interacting protein 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARL6IP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Control
ARL6IP4 Knockout 293T Cell Lysate
Publications
Read Publication using H00051329-M09.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARL6IP4 Antibody (5E5)

  • ADP-ribosylation-like factor 6 interacting protein 4
  • Aip-4
  • ARL-6-interacting protein 4
  • HSP-975
  • HSVI binding protein
  • HSVI-binding protein
  • MGC814
  • SFRS20
  • splicing factor, arginine/serine-rich 20
  • splicing regulator SRrp38
  • SR-15
  • SR-25ADP-ribosylation factor-like protein 6-interacting protein 4
  • SRp25 nuclear protein
  • SRp25aip-4
  • SRrp37

Background

ARL6IP4 interacts with ADP-ribosylation-like factor 6. ADP-ribosylation factors function as regulators of vesicular traffic and actin remodelling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Mouse Brain (cerebral cortex). ICC/IF image submitted by a verified customer review.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord using Rabbit antibody to RAC1, RAC2 (100-150) at 1:1000 dilution. Pre-absorption of the antibody with the immunising peptide completely abolishes the immunostaining (not shown).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
gamma-Synuclein
Antibody
NBP1-31209
Western Blot: gamma-Synuclein Antibody [NBP1-31209] - Various whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with gamma-Synuclein antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: gamma-Synuclein Antibody [NBP1-31209] - Synuclein-gamma Antibody [NBP1-31209] - HeLa cells, using gamma Synuclein antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Synuclein-gamma Antibody [NBP1-31209] - Paraffin-embedded mouse fore brain, gamma Synuclein antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Secretin R Antibody
NBP1-86125
Immunohistochemistry-Paraffin: Secretin R Antibody [NBP1-86125] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Secretin R Antibody [NBP1-86125] - Staining of human pancreas shows strong membranous positivity in interlobular ducts.
Immunohistochemistry-Paraffin: Secretin R Antibody [NBP1-86125] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
AKIP Antibody
NBP1-90202
Immunocytochemistry/Immunofluorescence: AKIP Antibody [NBP1-90202] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, mitochondria & vesicles.
Immunohistochemistry-Paraffin: AKIP Antibody [NBP1-90202] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HSP27 Antibody
NBP1-75477
Knockout Validated: HSP27 Antibody [NBP1-75477] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HSP27 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Rabbit Anti-Human HSP27 Polyclonal Antibody (Catalog # NBP1-75477) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (catalog number HAF008). Specific band was detected for HSP27 at approximately 27 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: HSP27 Antibody [NBP1-75477] - Analysis of Jurkat cell lysate (30ug) using anti-Hsp27 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: HSP27 Antibody [NBP1-75477] - Hsp27 Antibody [NBP1-75477] - HSP27 antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
AIP/ARA9 Antibody
(35-2)
NB100-127
Immunohistochemistry: AIP/ARA9 Antibody (35-2) [NB100-127] - Fig 1. Aryl hydrocarbon receptor interacting protein (AIP) immunostaining.A and B Examples of low AIP expression; C and D: Examples of high AIP expression; E Normal human pituitary staining with omitting primary antibody (negative control); F Normal human pituitary staining with AIP (positive control); Scale bar = 1000 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0117107) licensed under a CC-BY licence.
Simple Western: AIP/ARA9 Antibody (35-2) [NB100-127] - Simple Western lane view shows a specific band for AIP/ARA9 in 0.5 mg/ml of Hek293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: AIP/ARA9 Antibody (35-2) [NB100-127] - Detection on HEK 293T/17 cells. Lane 1: IP ARA9, WB ARA9, Lane 2: WB ARA9 with whole cell lysate. Photo courtesy of Liling Zeng, Boston University.
(4 Reviews)
(30 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
FAM53C Antibody
NBP1-86769
Western Blot: FAM53C Antibody [NBP1-86769] - Analysis in control (vector only transfected HEK293T lysate) and FAM53C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: FAM53C Antibody [NBP1-86769] - Staining of human testis shows cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.
Species: Hu
Applications: WB, IHC, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
ACRC Antibody
NBP1-85993
Immunocytochemistry/Immunofluorescence: ACRC Antibody [NBP1-85993] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACRC Antibody [NBP1-85993] - Staining in human testis and pancreas tissues.. Corresponding GCNA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACRC Antibody [NBP1-85993] - Staining of human pancreas shows no positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Flow Cytometry: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Flow cytometric analysis of GSTK1 was done on SiHa cells. The cells were fixed, permeabilized and stained with the primary antibody (1:100) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.Unlabelled sample was used as a control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Folic acid treatment restores endothelial specific DHFR expression and activity in Ang II-infused apoE null mice.DHFR expression (A, n?=?8-11) and activity (B, n?=?5-7) measured from endothelial cells (ECs) and EC-denuded aortas isolated from apoE null mice after 4 weeks of infusion. Data show that DHFR expression and activity was restored in FA treated animals specifically in the endothelial cells. eNOS was stained to show that isolation/removal of ECs from the vessels was successful. *p<0.05. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0088899) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10 Analysis of DHFR expression in HeLa.
(13 Publications)
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
ZCCHC17 Antibody
NBP1-57131
Western Blot: ZCCHC17 Antibody [NBP1-57131] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
ABI2 Antibody
H00010152-B01P
Western Blot: ABI2 Antibody [H00010152-B01P] - Analysis of ABI2 expression in Jurkat.
Immunocytochemistry/Immunofluorescence: ABI2 Antibody [H00010152-B01P] - Analysis of purified antibody to ABI2 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: ABI2 Antibody [H00010152-B01P] - Analysis of ABI2 expression in transfected 293T cell line by ABI2 polyclonal antibody. Lane 1: ABI2 transfected lysate(52.25 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ICC/IF
MAGI2 Antibody
AF7117
Western blot shows lysates of human brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for MAGI2 at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MAGI2 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to synaptic boutons and neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
MAGI2 was detected in immersion fixed U‑87 MG human glioblastoma/astrocytoma cell line using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, ICC
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(6 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
ARHGAP24 Antibody
NBP1-84161
Immunohistochemistry-Paraffin: ARHGAP24 Antibody [NBP1-84161] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
p73 Antibody
(5B429)
NBP2-24737
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Analysis of p73 in A) transfected cell lysate and B) HeLa cell lysate at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: p73 Antibody (5B429) [NBP2-24737] - p73 was detected in immersion fixed Hela human cell line using p73 [5B429] Monoclonal Antibody (Catalog # NBP2-24737) at 3 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and in the nuclei.
Immunohistochemistry-Paraffin: p73 Antibody (5B429) [NBP2-24737] - FFPE breast cancer probed with p73 antibody at 5 ug/ml. Human tissue was used for this test. Staining of tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(55 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for ARL6IP4 Antibody (H00051329-M09)(1)


Reviews for ARL6IP4 Antibody (H00051329-M09) (0)

There are no reviews for ARL6IP4 Antibody (H00051329-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARL6IP4 Antibody (H00051329-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

ARL6IP4 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ARL6IP4 Products

Bioinformatics Tool for ARL6IP4 Antibody (H00051329-M09)

Discover related pathways, diseases and genes to ARL6IP4 Antibody (H00051329-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL6IP4 Antibody (H00051329-M09)

Discover more about diseases related to ARL6IP4 Antibody (H00051329-M09).
 

Pathways for ARL6IP4 Antibody (H00051329-M09)

View related products by pathway.

PTMs for ARL6IP4 Antibody (H00051329-M09)

Learn more about PTMs related to ARL6IP4 Antibody (H00051329-M09).

Blogs on ARL6IP4

There are no specific blogs for ARL6IP4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL6IP4 Antibody (5E5) and receive a gift card or discount.


Bioinformatics

Gene Symbol ARL6IP4
Entrez
OMIM
Uniprot