ZBTB7A/Pokemon Recombinant Protein Antigen

Images

 
There are currently no images for ZBTB7A/Pokemon Protein (NBP2-38550PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZBTB7A/Pokemon Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZBTB7A.

Source: E. coli

Amino Acid Sequence: AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZBTB7A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38550.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZBTB7A/Pokemon Recombinant Protein Antigen

  • DKFZp547O146
  • Factor binding IST protein 1
  • Factor that binds to inducer of short transcripts protein 1
  • FBI-1
  • FBI-1POK erythroid myeloid ontogenic factor
  • FBI1TTF-I-interacting peptide 21
  • HIV-1 inducer of short transcripts binding protein
  • Leukemia/lymphoma-related factor
  • LRF
  • LRFHIV-1 1st-binding protein 1
  • lymphoma related factor
  • MGC99631
  • Pokemon
  • TIP21
  • ZBTB7A
  • ZBTB7zinc finger and BTB domain containing 7
  • zinc finger and BTB domain containing 7A
  • zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcriptsbinding protein
  • zinc finger and BTB domain-containing protein 7A
  • Zinc finger protein 857A
  • ZNF857APOZ and Krueppel erythroid myeloid ontogenic factor

Background

Pokemon (POK Erythroid Myeloid Ontogenic factor) is part of the POK gene family that encodes proteins. It is an oncogene, but its role is unique in that it controls the activity of other oncogenes. POK proteins are critical in embryonic development, cellular differentiation, and oncogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NB120-5802
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
M5000
Species: Mu
Applications: ELISA
NBP2-34014
Species: Hu
Applications: IHC,  IHC-P
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB

Publications for ZBTB7A/Pokemon Protein (NBP2-38550PEP) (0)

There are no publications for ZBTB7A/Pokemon Protein (NBP2-38550PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB7A/Pokemon Protein (NBP2-38550PEP) (0)

There are no reviews for ZBTB7A/Pokemon Protein (NBP2-38550PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZBTB7A/Pokemon Protein (NBP2-38550PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZBTB7A/Pokemon Products

Research Areas for ZBTB7A/Pokemon Protein (NBP2-38550PEP)

Find related products by research area.

Blogs on ZBTB7A/Pokemon

There are no specific blogs for ZBTB7A/Pokemon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZBTB7A/Pokemon Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB7A