ZBTB40 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ZBTB40 Antibody - BSA Free (NBP2-84339) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of ZBTB40. Peptide sequence: CSVQGQVVRDVSAPSSETFRKEPEKPQVEILSSEGAGEPHSSPELAATPG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ZBTB40 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ZBTB40 Antibody - BSA Free
Background
ZBTB40 (zinc-finger and BTB domain-containing protein 40) is a krueppel C2H2-type zinc finger protein and contains one BTB domain (POZ) domain and 12 C2H2-type zinc fingers. The function of ZBTB40 is uncharacterized; however due to its structural elements, it is considered to be a putative transcriptional regulator. An alternate name for the ZBTB40 gene is KIAA0478.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: WB
Species: Hu
Applications: WB
Publications for ZBTB40 Antibody (NBP2-84339) (0)
There are no publications for ZBTB40 Antibody (NBP2-84339).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZBTB40 Antibody (NBP2-84339) (0)
There are no reviews for ZBTB40 Antibody (NBP2-84339).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZBTB40 Antibody (NBP2-84339) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZBTB40 Products
Blogs on ZBTB40