![Immunocytochemistry/Immunofluorescence: YY2 Antibody [NBP2-57462] - Staining of human cell line HeLa shows localization to nuclear bodies.](http://images.novusbio.com/fullsize/YY2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57462-img0001.jpg "Immunocytochemistry/Immunofluorescence: YY2 Antibody [NBP2-57462] - Staining of human cell line HeLa shows localization to nuclear bodies.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | YY2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | YY2 |
![Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining in human testis and prostate tissues using anti-YY2 antibody. Corresponding YY2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/YY2-Antibody-Immunohistochemistry-Paraffin-NBP2-57462-img0004.jpg "Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining in human testis and prostate tissues using anti-YY2 antibody. Corresponding YY2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize/YY2-Antibody-Immunohistochemistry-Paraffin-NBP2-57462-img0002.jpg "Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining of human prostate shows low expression as expected.")
![Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/YY2-Antibody-Immunohistochemistry-Paraffin-NBP2-57462-img0003.jpg "Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining of human testis shows high expression.")
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_812.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_813.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/Adiponectin_DRP300_ELISA_173.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")