RING1 Antibody

Images

 
Western Blot: RING1 Antibody [NBP1-80830] - Analysis in control (vector only transfected HEK293T lysate) and RING1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RING1 Antibody [NBP1-80830] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human nasopharynx shows strong nuclear and moderate cytoplasmic positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Endometrium shows strong nuclear positivity in glandular cells and cells in endometrial stroma.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RING1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVS
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RING1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RING1 Protein (NBP1-80830PEP)
Publications
Read Publication using
NBP1-80830 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RING1 Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • Polycomb complex protein RING1
  • Really interesting new gene 1 protein
  • ring finger protein 1RING1A
  • RING1
  • RNF1
  • RNF1E3 ubiquitin-protein ligase RING1

Background

RING1 belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RING1 Antibody (NBP1-80830)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for RING1 Antibody (NBP1-80830) (0)

There are no reviews for RING1 Antibody (NBP1-80830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RING1 Antibody (NBP1-80830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RING1 Products

Research Areas for RING1 Antibody (NBP1-80830)

Find related products by research area.

Blogs on RING1

There are no specific blogs for RING1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RING1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RING1
Entrez
Uniprot