RING1 Antibody

Images

 
Western Blot: RING1 Antibody [NBP1-80830] - Analysis in control (vector only transfected HEK293T lysate) and RING1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RING1 Antibody [NBP1-80830] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human nasopharynx shows strong nuclear and moderate cytoplasmic positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Endometrium shows strong nuclear positivity in glandular cells and cells in endometrial stroma.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RING1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVS
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RING1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RING1 Protein (NBP1-80830PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RING1 Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • Polycomb complex protein RING1
  • Really interesting new gene 1 protein
  • ring finger protein 1RING1A
  • RING1
  • RNF1
  • RNF1E3 ubiquitin-protein ligase RING1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006045-M01
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-15125
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5827
Species: Hu, Mu
Applications: WB
NBP2-02009
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84620
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-37371
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP1-84309
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1240
Species: Hu
Applications: PEP-ELISA, WB
NBP2-38536
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
AF1556
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB

Publications for RING1 Antibody (NBP1-80830) (0)

There are no publications for RING1 Antibody (NBP1-80830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RING1 Antibody (NBP1-80830) (0)

There are no reviews for RING1 Antibody (NBP1-80830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RING1 Antibody (NBP1-80830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RING1 Products

Bioinformatics Tool for RING1 Antibody (NBP1-80830)

Discover related pathways, diseases and genes to RING1 Antibody (NBP1-80830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RING1 Antibody (NBP1-80830)

Discover more about diseases related to RING1 Antibody (NBP1-80830).
 

Pathways for RING1 Antibody (NBP1-80830)

View related products by pathway.

PTMs for RING1 Antibody (NBP1-80830)

Learn more about PTMs related to RING1 Antibody (NBP1-80830).
 

Research Areas for RING1 Antibody (NBP1-80830)

Find related products by research area.

Blogs on RING1

There are no specific blogs for RING1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RING1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RING1
Entrez
Uniprot