YY1 Antibody (4D2)

Images

 
Western Blot: YY1 Antibody (4D2) [H00007528-M03] - Analysis of YY1 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: YY1 Antibody (4D2) [H00007528-M03] - Analysis of monoclonal antibody to YY1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: YY1 Antibody (4D2) [H00007528-M03] - Analysis of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 3 ug/ml
ELISA: YY1 Antibody (4D2) [H00007528-M03] - Detection limit for recombinant GST tagged YY1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

YY1 Antibody (4D2) Summary

Immunogen
YY1 (NP_003394, 221 a.a. - 320 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Specificity
YY1 - YY1 transcription factor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
YY1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for YY1 Antibody (4D2)

  • Delta transcription factor
  • DELTA
  • INO80SYY-1
  • NF-E1
  • NF-E1INO80 complex subunit S
  • transcriptional repressor protein YY1
  • UCRBP
  • Yin and Yang 1 protein
  • Yin and yang 1
  • YIN-YANG-1
  • YY1 transcription factor
  • YY1

Background

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007528-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for YY1 Antibody (H00007528-M03) (0)

There are no publications for YY1 Antibody (H00007528-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YY1 Antibody (H00007528-M03) (0)

There are no reviews for YY1 Antibody (H00007528-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for YY1 Antibody (H00007528-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for YY1 Antibody (H00007528-M03)

Discover related pathways, diseases and genes to YY1 Antibody (H00007528-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YY1 Antibody (H00007528-M03)

Discover more about diseases related to YY1 Antibody (H00007528-M03).
 

Pathways for YY1 Antibody (H00007528-M03)

View related products by pathway.

PTMs for YY1 Antibody (H00007528-M03)

Learn more about PTMs related to YY1 Antibody (H00007528-M03).
 

Research Areas for YY1 Antibody (H00007528-M03)

Find related products by research area.

Blogs on YY1

There are no specific blogs for YY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YY1 Antibody (4D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol YY1
Entrez
OMIM
Uniprot