YBEY Antibody

Western Blot: YBEY Antibody [NBP1-89876] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: YBEY Antibody [NBP1-89876] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: YBEY Antibody [NBP1-89876] - Analysis in human cell line NTERA-2.

Immunohistochemistry-Paraffin: YBEY Antibody [NBP1-89876] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in seminiferous ducts.

Immunohistochemistry-Paraffin: YBEY Antibody [NBP1-89876] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: YBEY Antibody [NBP1-89876] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

YBEY Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAGEFP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YBEY
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  YBEY Protein (NBP1-89876PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for YBEY Antibody

• C21orf57
• chromosome 21 open reading frame 57
• FLJ46907
• putative metalloprotease C21orf57
• ybeY metallopeptidase (putative)

Background

C21orf57 may have metalloprotease activity (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YBEY