YBEY Antibody


Western Blot: YBEY Antibody [NBP1-89876] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: YBEY Antibody [NBP1-89876] - Staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.
Western Blot: YBEY Antibody [NBP1-89876] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: YBEY Antibody [NBP1-89876] - Analysis in human cell line NTERA-2.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

YBEY Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAGEFP
Specificity of human, mouse, rat YBEY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
YBEY Protein (NBP1-89876PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for YBEY Antibody

  • C21orf57
  • chromosome 21 open reading frame 57
  • FLJ46907
  • putative metalloprotease C21orf57
  • ybeY metallopeptidase (putative)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for YBEY Antibody (NBP1-89876) (0)

There are no publications for YBEY Antibody (NBP1-89876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YBEY Antibody (NBP1-89876) (0)

There are no reviews for YBEY Antibody (NBP1-89876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YBEY Antibody (NBP1-89876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional YBEY Products

Bioinformatics Tool for YBEY Antibody (NBP1-89876)

Discover related pathways, diseases and genes to YBEY Antibody (NBP1-89876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for YBEY Antibody (NBP1-89876)

View related products by pathway.

Blogs on YBEY

There are no specific blogs for YBEY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our YBEY Antibody and receive a gift card or discount.


Gene Symbol YBEY