PRED31 Antibody

Images

 
Western Blot: PRED31 Antibody [NBP2-14420] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: PRED31 Antibody [NBP2-14420] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRED31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKN YKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6ORF203
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRED31 Protein (NBP2-14420PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRED31 Antibody

  • C6orf203
  • chromosome 6 open reading frame 203
  • FLJ34245
  • HSPC230
  • hypothetical protein LOC51250
  • PRED31
  • RP11-59I9.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86818
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-86817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88936
Species: Hu
Applications: IHC, IHC-P
NBP1-88279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88280
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81767
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-10493
Species: Hu
NBP1-98259
Species: Hu
Applications: WB
NBP1-89876
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14420
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRED31 Antibody (NBP2-14420) (0)

There are no publications for PRED31 Antibody (NBP2-14420).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRED31 Antibody (NBP2-14420) (0)

There are no reviews for PRED31 Antibody (NBP2-14420). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRED31 Antibody (NBP2-14420) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRED31 Products

Bioinformatics Tool for PRED31 Antibody (NBP2-14420)

Discover related pathways, diseases and genes to PRED31 Antibody (NBP2-14420). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRED31

There are no specific blogs for PRED31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRED31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C6ORF203