PRED31 Antibody

Images

 
Immunohistochemistry-Paraffin: PRED31 Antibody [NBP2-14420] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: PRED31 Antibody [NBP2-14420] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PRED31 Antibody [NBP2-14420] - Staining of human prostate shows moderate granular cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: PRED31 Antibody [NBP2-14420] - Staining of human rectum shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRED31 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6ORF203
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRED31 Protein (NBP2-14420PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRED31 Antibody

  • C6orf203
  • chromosome 6 open reading frame 203
  • FLJ34245
  • HSPC230
  • hypothetical protein LOC51250
  • PRED31
  • RP11-59I9.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86818
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90676
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89395
Species: Hu
Applications: IHC, IHC-P, WB
MAB2576
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-88937
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80046
Species: Hu
Applications: WB
NBP1-88706
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88280
Species: Hu
Applications: IHC, IHC-P
NBP1-56678
Species: Hu
Applications: IHC, IHC-P, WB
NBL1-10493
Species: Hu
Applications: WB
NBP1-98259
Species: Hu
Applications: WB
NBP1-89876
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DMB00
Species: Hu
Applications: ELISA
NBP1-85912
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PRED31 Antibody (NBP2-14420) (0)

There are no publications for PRED31 Antibody (NBP2-14420).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRED31 Antibody (NBP2-14420) (0)

There are no reviews for PRED31 Antibody (NBP2-14420). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRED31 Antibody (NBP2-14420) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRED31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C6ORF203