Novus Biologicals products are now on bio-techne.com

SETD4 Antibody

Images

 
Western Blot: SETD4 Antibody [NBP1-80046] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: SETD4 Antibody [NBP1-80046] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SETD4 Antibody [NBP1-80046] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: SETD4 Antibody [NBP1-80046] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

SETD4 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the C terminal of human C21ORF18. Peptide sequence LTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETN. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SETD4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for SETD4 Antibody

  • C21orf18
  • C21orf27
  • chromosome 21 open reading frame 18
  • chromosome 21 open reading frame 27
  • SET domain containing 4
  • SET domain-containing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86818
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90676
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89395
Species: Hu
Applications: IHC, IHC-P, WB
MAB2576
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-88937
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88706
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88280
Species: Hu
Applications: IHC, IHC-P
NBP1-56678
Species: Hu
Applications: IHC, IHC-P, WB
NBL1-10493
Species: Hu
Applications: WB
NBP2-14420
Species: Hu
Applications: IHC, IHC-P
NBP1-98259
Species: Hu
Applications: WB
NBP1-89876
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DMB00
Species: Hu
Applications: ELISA
NBP1-85912
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SETD4 Antibody (NBP1-80046) (0)

There are no publications for SETD4 Antibody (NBP1-80046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETD4 Antibody (NBP1-80046) (0)

There are no reviews for SETD4 Antibody (NBP1-80046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SETD4 Antibody (NBP1-80046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SETD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD4
Uniprot