FAM207A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM207A Antibody [NBP1-90676] - Staining of human cell line U-2 OS shows positivity in golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: FAM207A Antibody [NBP1-90676] - Staining of human cerebellum shows strong cytoplasmic positivity(granular pattern) in Purkinje cells.
Immunohistochemistry: FAM207A Antibody [NBP1-90676] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

FAM207A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFINTNIFARTKIDPSALVQKLELDVRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM207A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
FAM207A Protein (NBP1-90676PEP)

Alternate Names for FAM207A Antibody

  • chromosome 21 open reading frame 70
  • hypothetical protein LOC85395
  • PRED56

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86818
Species: Hu
Applications: WB, IHC, IHC-P
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-86817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88280
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81767
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14420
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98259
Species: Hu
Applications: WB
NBP1-89876
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85912
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45960
Species: Hu, Mu, Mk
Applications: WB, IHC, IF

Publications for FAM207A Antibody (NBP1-90676) (0)

There are no publications for FAM207A Antibody (NBP1-90676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM207A Antibody (NBP1-90676) (0)

There are no reviews for FAM207A Antibody (NBP1-90676). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM207A Antibody (NBP1-90676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM207A Antibody Products

Related Products by Gene

Bioinformatics Tool for FAM207A Antibody (NBP1-90676)

Discover related pathways, diseases and genes to FAM207A Antibody (NBP1-90676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM207A

There are no specific blogs for FAM207A, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol FAM207A

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-90676 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought