FAM207A Antibody


Immunocytochemistry/ Immunofluorescence: FAM207A Antibody [NBP1-90676] - Staining of human cell line U-2 OS shows positivity in golgi apparatus and vesicles.
Immunohistochemistry-Paraffin: FAM207A Antibody [NBP1-90676] - Staining of human cerebellum shows strong cytoplasmic positivity(granular pattern) in Purkinje cells.
Immunohistochemistry: FAM207A Antibody [NBP1-90676] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

FAM207A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:AFINTNIFARTKIDPSALVQKLELDVRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
FAM207A Protein (NBP1-90676PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM207A Antibody

  • chromosome 21 open reading frame 70
  • hypothetical protein LOC85395
  • PRED56


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Mk
Applications: WB, IHC, IF

Publications for FAM207A Antibody (NBP1-90676) (0)

There are no publications for FAM207A Antibody (NBP1-90676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM207A Antibody (NBP1-90676) (0)

There are no reviews for FAM207A Antibody (NBP1-90676). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM207A Antibody (NBP1-90676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM207A Antibody Products

Related Products by Gene

Bioinformatics Tool for FAM207A Antibody (NBP1-90676)

Discover related pathways, diseases and genes to FAM207A Antibody (NBP1-90676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM207A

There are no specific blogs for FAM207A, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our FAM207A Antibody and receive a gift card or discount.


Gene Symbol FAM207A

Customers Who Bought This Also Bought