C21orf91 Antibody

Images

 
Western Blot: C21orf91 Antibody [NBP1-88280] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: C21orf91 Antibody [NBP1-88280] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C21orf91 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRTGMKSHLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C21ORF91
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C21orf91 Protein (NBP1-88280PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C21orf91 Antibody

  • C21orf14
  • C21orf38
  • C21orf7
  • chromosome 21 open reading frame 38
  • chromosome 21 open reading frame 91
  • CSSG1
  • DKFZp781D1223
  • early undifferentiated retina and lens
  • EURL
  • protein EURL homolog
  • YG81
  • YG81C21orf14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86818
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-86817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-88936
Species: Hu
Applications: IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP2-13325
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-88706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88280
Species: Hu
Applications: WB, IHC, IHC-P

Publications for C21orf91 Antibody (NBP1-88280) (0)

There are no publications for C21orf91 Antibody (NBP1-88280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C21orf91 Antibody (NBP1-88280) (0)

There are no reviews for C21orf91 Antibody (NBP1-88280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C21orf91 Antibody (NBP1-88280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C21orf91 Products

Bioinformatics Tool for C21orf91 Antibody (NBP1-88280)

Discover related pathways, diseases and genes to C21orf91 Antibody (NBP1-88280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C21orf91 Antibody (NBP1-88280)

Discover more about diseases related to C21orf91 Antibody (NBP1-88280).

Blogs on C21orf91

There are no specific blogs for C21orf91, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C21orf91 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C21ORF91