YB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: YB1 Antibody [NBP2-58086] - Staining of human cell line A-431 shows localization to nuclear membrane, cytosol & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
Specificity
Specificity of human YB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YBX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for YB1 Antibody

  • BP-8
  • CBF-A
  • class II, Y box-binding protein I
  • CSDA2
  • CSDB
  • DBPB CCAAT-binding transcription factor I subunit A
  • EFI-A
  • Enhancer factor I subunit A
  • MDR-NF1
  • MGC104858
  • MGC110976
  • MGC117250
  • NSEP1 Y-box-binding protein 1
  • nuclease-sensitive element-binding protein 1
  • Y box binding protein 1
  • YB1 DNA-binding protein B
  • YB-1 Y-box transcription factor
  • YBX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76954
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NBP1-81406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15039
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ChIP

Publications for YB1 Antibody (NBP2-58086) (0)

There are no publications for YB1 Antibody (NBP2-58086).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YB1 Antibody (NBP2-58086) (0)

There are no reviews for YB1 Antibody (NBP2-58086). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YB1 Antibody (NBP2-58086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional YB1 Products

Bioinformatics Tool for YB1 Antibody (NBP2-58086)

Discover related pathways, diseases and genes to YB1 Antibody (NBP2-58086). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YB1 Antibody (NBP2-58086)

Discover more about diseases related to YB1 Antibody (NBP2-58086).
 

Pathways for YB1 Antibody (NBP2-58086)

View related products by pathway.

PTMs for YB1 Antibody (NBP2-58086)

Learn more about PTMs related to YB1 Antibody (NBP2-58086).
 

Research Areas for YB1 Antibody (NBP2-58086)

Find related products by research area.

Blogs on YB1.

New Techniques Using Phosphoserine Antibodies
Phosphoserine, the phosphorylated modification of the amino acid serine, is a central post-translational modification within a cell for many biological and biomedical processes. The phosphorylation of specifically four residue types - histidine, serin...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YBX1