![Western Blot: XPNPEP3 Antibody [NBP1-89030] - Analysis in human cell lines HEK293 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.](http://images.novusbio.com/fullsize/XPNPEP3-Antibody-Western-Blot-NBP1-89030-img0011.jpg "Western Blot: XPNPEP3 Antibody [NBP1-89030] - Analysis in human cell lines HEK293 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQ |
| Predicted Species | Mouse (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | XPNPEP3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Publication using NBP1-89030 | Applications | Species |
|---|---|---|
| O'Toole JF, Liu Y, Davis EE et al. Individuals with mutations in XPNPEP3, which encodes a mitochondrial protein, develop a nephronophthisis-like nephropathy. J Clin Invest 2010-03-01 [PMID: 20179356] |
Secondary Antibodies |
Isotype Controls |
Research Areas for XPNPEP3 Antibody (NBP1-89030)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | XPNPEP3 |
![Western Blot: XPNPEP3 Antibody [NBP1-89030] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/XPNPEP3-Antibody-Western-Blot-NBP1-89030-img0012.jpg "Western Blot: XPNPEP3 Antibody [NBP1-89030] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] -Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-89030_rabbit-polyclonal-xpnpep3-antibody-immunohistochemistry-paraffin-1942024122853..jpg "Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] -Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/antibody/nbp1-89030_rabbit-polyclonal-xpnpep3-antibody-immunohistochemistry-paraffin-1942024122945..jpg "Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] - Staining of human testis shows strong cytoplasmic positivity in spermatids.](http://images.novusbio.com/fullsize/antibody/nbp1-89030_rabbit-polyclonal-xpnpep3-antibody-immunohistochemistry-paraffin-1942024123034..jpg "Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] - Staining of human testis shows strong cytoplasmic positivity in spermatids.")
![Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] -Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/antibody/nbp1-89030_rabbit-polyclonal-xpnpep3-antibody-immunohistochemistry-paraffin-1942024123126..jpg "Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] -Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")