XPNPEP3 Antibody

Images

 
Western Blot: XPNPEP3 Antibody [NBP1-89030] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more
Immunohistochemistry-Paraffin: XPNPEP3 Antibody [NBP1-89030] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: XPNPEP3 Antibody [NBP1-89030] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XPNPEP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XPNPEP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
XPNPEP3 Protein (NBP1-89030PEP)
Publications
Read Publication using NBP1-89030.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XPNPEP3 Antibody

  • Aminopeptidase P3
  • APP3probable Xaa-Pro aminopeptidase 3
  • NPHPL1EC 3.4.11.9
  • X-Pro aminopeptidase 3
  • X-prolyl aminopeptidase (aminopeptidase P) 3, putative

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
MAB24901
Species: Hu
Applications: WB, IP, Neut
NBP1-80613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-74593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-82539
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
DDX0520P-100
Species: Hu
Applications: Flow, IHC, IHC-Fr, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2898
Species: Mu
Applications: WB, IP
NBP2-01992
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004867-D01P
Species: Hu, Mu
Applications: WB
NB400-146
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-54964
Species: Hu
Applications: WB, ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-89030
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for XPNPEP3 Antibody (NBP1-89030)(1)

Reviews for XPNPEP3 Antibody (NBP1-89030) (0)

There are no reviews for XPNPEP3 Antibody (NBP1-89030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XPNPEP3 Antibody (NBP1-89030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XPNPEP3 Products

Bioinformatics Tool for XPNPEP3 Antibody (NBP1-89030)

Discover related pathways, diseases and genes to XPNPEP3 Antibody (NBP1-89030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPNPEP3 Antibody (NBP1-89030)

Discover more about diseases related to XPNPEP3 Antibody (NBP1-89030).
 

Pathways for XPNPEP3 Antibody (NBP1-89030)

View related products by pathway.

PTMs for XPNPEP3 Antibody (NBP1-89030)

Learn more about PTMs related to XPNPEP3 Antibody (NBP1-89030).

Blogs on XPNPEP3

There are no specific blogs for XPNPEP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPNPEP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XPNPEP3