XPA Antibody

Images

 
Western Blot: XPA Antibody [H00007507-B01P] - Analysis of XPA expression in human liver.
Immunocytochemistry/ Immunofluorescence: XPA Antibody [H00007507-B01P] - Analysis of purified antibody to XPA on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: XPA Antibody [H00007507-B01P] - Analysis of XPA expression in transfected 293T cell line by XPA polyclonal antibody. Lane 1: XPA transfected lysate(30.03 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

XPA Antibody Summary

Immunogen
XPA (NP_000371.1, 1 a.a. - 273 a.a.) full-length human protein. MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
XPA
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XPA Antibody

  • DNA repair protein complementing XP-A cells
  • excision repair-controlling
  • Xeroderma pigmentosum group A-complementing protein
  • xeroderma pigmentosum, complementation group A
  • XP1
  • XPA
  • XPACXP1

Background

This gene encodes a zinc finger protein involved in DNA excision repair. The encoded protein is part of the NER (nucleotide excision repair) complext which is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens. Mutations in this gene are associated with xeroderma pigmentosum complementation group A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBL1-11392
Species: Hu
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45514
Species: Hu
Applications: WB, IHC
H00007507-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for XPA Antibody (H00007507-B01P) (0)

There are no publications for XPA Antibody (H00007507-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPA Antibody (H00007507-B01P) (0)

There are no reviews for XPA Antibody (H00007507-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XPA Antibody (H00007507-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XPA Products

Bioinformatics Tool for XPA Antibody (H00007507-B01P)

Discover related pathways, diseases and genes to XPA Antibody (H00007507-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPA Antibody (H00007507-B01P)

Discover more about diseases related to XPA Antibody (H00007507-B01P).
 

Pathways for XPA Antibody (H00007507-B01P)

View related products by pathway.

PTMs for XPA Antibody (H00007507-B01P)

Learn more about PTMs related to XPA Antibody (H00007507-B01P).
 

Research Areas for XPA Antibody (H00007507-B01P)

Find related products by research area.

Blogs on XPA.

Role of RASSF1A in Death Receptor-Dependent Apoptosis
Death-receptor apoptosis, or cell death, is essential for cellular growth regulation; its disruption is expressed in a variety of cancers. We at Novus Biologicals are one of the leading antibody suppliersfor apoptosis and cancer research groups, and t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XPA
Entrez
Uniprot