Recombinant Human xCT Protein

Images

 
SDS-Page: Recombinant Human xCT Protein [H00023657-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human xCT Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-501 of Human SLC7A11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLC7A11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human xCT Protein

  • Amino acid transport system xc-
  • Calcium channel blocker resistance protein CCBR1
  • CCBR1
  • cystine/glutamate transporter
  • Member 11 (Slc7a11)
  • SLC7A11
  • Solute carrier family 7 member 11
  • solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
  • xCT
  • xCTCCBR1

Background

SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-59632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023657-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for xCT Recombinant Protein (H00023657-P01) (0)

There are no publications for xCT Recombinant Protein (H00023657-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for xCT Recombinant Protein (H00023657-P01) (0)

There are no reviews for xCT Recombinant Protein (H00023657-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for xCT Recombinant Protein (H00023657-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional xCT Products

Bioinformatics Tool for xCT Recombinant Protein (H00023657-P01)

Discover related pathways, diseases and genes to xCT Recombinant Protein (H00023657-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for xCT Recombinant Protein (H00023657-P01)

Discover more about diseases related to xCT Recombinant Protein (H00023657-P01).
 

Pathways for xCT Recombinant Protein (H00023657-P01)

View related products by pathway.

PTMs for xCT Recombinant Protein (H00023657-P01)

Learn more about PTMs related to xCT Recombinant Protein (H00023657-P01).
 

Research Areas for xCT Recombinant Protein (H00023657-P01)

Find related products by research area.

Blogs on xCT.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

xCT: The Membrane's Gatekeeper
xCT is an obligate, electroneutral, membrane-bound anionic transporter responsible for regulating particular amino acid gradients via their transport through plasma membrane. The antiporter xCT superficially resembles an ion channel and preferentially...  Read full blog post.

xCT: Amino Acid Transport and Disorders of the Central Nervous System
xCT, encoded by the gene SLC7A11, is a member of the heterodimeric amino acid transporter family. Proteins within this family are linked to one another via a disulphide bond to form heterodimers consisting of one light subunit and one heavy subunit (1...  Read full blog post.

xCT: Friend or Foe?
There are two opposing sides to the controversial cysteine/glutamate antiporter. On one hand, it can be viewed a guardian of the cell, protecting it from the damaging oxidative stress that can cause cell death and even cancer. But, conversely, it has...  Read full blog post.

Glutathione and xCT: Chemoresistance in Tumor Cells
Glutathione, called GSH in its reduced form and GSSG or L(-)-Glutathione in its oxidized form, is an endogenous antioxidant found in most cells in the body. Glutathione's functions include detoxifying xenobiotics from the body, assisting in membrane t...  Read full blog post.

Customers Who Bought This Also Bought

xCT Antibody
NB300-318

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human xCT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A11
Entrez