XCL1/Lymphotactin Antibody (1E1.)

Images

 
Immunohistochemistry-Paraffin: XCL1/Lymphotactin Antibody (1E1) [H00006375-M01] - Analysis of monoclonal antibody to XCL1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1E1.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

XCL1/Lymphotactin Antibody (1E1.) Summary

Immunogen
XCL1 (NP_002986, 22 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Specificity
XCL1 - chemokine (C motif) ligand 1 (1E1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
XCL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XCL1/Lymphotactin Antibody (1E1.)

  • ATAC
  • ATACSmall-inducible cytokine C1
  • C motif chemokine 1
  • chemokine (C motif) ligand 1
  • Cytokine SCM-1
  • LPTNSCM-1-alpha
  • LTNXC chemokine ligand 1
  • Lymphotactin
  • lymphotaxin
  • SCM-1 alpha
  • SCM-1
  • SCM1A
  • SCM-1a
  • SCYC1SCM1
  • single cysteine motif 1a
  • small inducible cytokine subfamily C, member 1 (lymphotactin)
  • XCL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF857
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for XCL1/Lymphotactin Antibody (H00006375-M01) (0)

There are no publications for XCL1/Lymphotactin Antibody (H00006375-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XCL1/Lymphotactin Antibody (H00006375-M01) (0)

There are no reviews for XCL1/Lymphotactin Antibody (H00006375-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XCL1/Lymphotactin Antibody (H00006375-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XCL1/Lymphotactin Products

Bioinformatics Tool for XCL1/Lymphotactin Antibody (H00006375-M01)

Discover related pathways, diseases and genes to XCL1/Lymphotactin Antibody (H00006375-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XCL1/Lymphotactin Antibody (H00006375-M01)

Discover more about diseases related to XCL1/Lymphotactin Antibody (H00006375-M01).
 

Pathways for XCL1/Lymphotactin Antibody (H00006375-M01)

View related products by pathway.

PTMs for XCL1/Lymphotactin Antibody (H00006375-M01)

Learn more about PTMs related to XCL1/Lymphotactin Antibody (H00006375-M01).
 

Research Areas for XCL1/Lymphotactin Antibody (H00006375-M01)

Find related products by research area.

Blogs on XCL1/Lymphotactin

There are no specific blogs for XCL1/Lymphotactin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XCL1/Lymphotactin Antibody (1E1.) and receive a gift card or discount.

Bioinformatics

Gene Symbol XCL1
Entrez
Uniprot