XAB1 Antibody

Images

 
Western Blot: XAB1 Antibody [NBP1-90072] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: XAB1 Antibody [NBP1-90072] - Staining of human gall bladder shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XAB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
XAB1 Protein (NBP1-90072PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XAB1 Antibody

  • ATP(GTP)-binding protein
  • ATPBD1A
  • GPN-loop GTPase 1
  • GTPase
  • MBD2-interacting protein
  • MBDin
  • MBDINXPA binding protein 1
  • XAB1FLJ51176
  • XPA-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-38854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
AF3296
Species: Hu, Mu, Rt
Applications: WB
AF6349
Species: Hu, Mu, Rt
Applications: WB
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP

Publications for XAB1 Antibody (NBP1-90072) (0)

There are no publications for XAB1 Antibody (NBP1-90072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XAB1 Antibody (NBP1-90072) (0)

There are no reviews for XAB1 Antibody (NBP1-90072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XAB1 Antibody (NBP1-90072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XAB1 Products

Bioinformatics Tool for XAB1 Antibody (NBP1-90072)

Discover related pathways, diseases and genes to XAB1 Antibody (NBP1-90072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XAB1 Antibody (NBP1-90072)

Discover more about diseases related to XAB1 Antibody (NBP1-90072).
 

Pathways for XAB1 Antibody (NBP1-90072)

View related products by pathway.

PTMs for XAB1 Antibody (NBP1-90072)

Learn more about PTMs related to XAB1 Antibody (NBP1-90072).
 

Research Areas for XAB1 Antibody (NBP1-90072)

Find related products by research area.

Blogs on XAB1

There are no specific blogs for XAB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XAB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPN1