WSB1 Antibody (3E10) - Azide and BSA Free

Sandwich ELISA: WSB1 Antibody (3E10) [H00026118-M01] - Detection limit for recombinant GST tagged WSB1 is 10 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WSB1 Antibody (3E10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse WSB1 Antibody (3E10) - Azide and BSA Free (H00026118-M01) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: WSB1 (AAH21110.1, 53 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG
• Specificity: WSB1 - WD repeat and SOCS box-containing 1 (3E10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: WSB1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WSB1 Antibody (3E10) - Azide and BSA Free

• DKFZp564B0482
• SOCS box-containing WD protein SWiP-1
• SWIP1DKFZp564A122
• WD repeat and SOCS box containing 1
• WD repeat and SOCS box-containing 1
• WD repeat and SOCS box-containing protein 1
• WSB-1

Background

This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WSB1
• Entrez:
  • 26118(Human)
• Uniprot:
  • AAH21110(Human)