Wnt16 Antibody

Images

 
Immunohistochemistry-Paraffin: Wnt16 Antibody [NBP1-86403] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Wnt16 Protein (NBP1-86403PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Wnt16 Antibody

  • protein Wnt-16
  • wingless-type MMTV integration site family, member 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF475
Species: Mu
Applications: IHC, WB
AF3157
Species: Hu
Applications: IHC, WB
NBP2-20913
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
6179-WN/CF
Species: Hu
Applications: BA
AF3460
Species: Hu
Applications: IHC, WB
NBP2-75713
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
645-WN/CF
Species: Hu, Mu
Applications: BA
3669-WN/CF
Species: Mu
Applications: BA
7347-WN/CF
Species: Hu
Applications: BA
AF3464
Species: Hu
Applications: IHC, WB
NBP2-46367
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4109
Species: Hu
Applications: IHC, WB
NB100-59026
Species: Bt, Bv, Ca, Hu, Pm, Pm, Rb
Applications: IHC, IHC-P
7196-WN/CF
Species: Hu
Applications: BA
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
5396-SF
Species: Hu
Applications: BA
NBP1-86403
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Wnt16 Antibody (NBP1-86403) (0)

There are no publications for Wnt16 Antibody (NBP1-86403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt16 Antibody (NBP1-86403) (0)

There are no reviews for Wnt16 Antibody (NBP1-86403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Wnt16 Antibody (NBP1-86403). (Showing 1 - 1 of 1 FAQ).

  1. Do you think this would work for IHC in mouse tissue?
    • Unfortunately this antibody has only been validated in human samples; however the homology of the immunogen sequence to the mouse protein is 92%. If you are interested in trying this antibody in mouse samples our Innovator's Reward program can be of use to you.

Secondary Antibodies

 

Isotype Controls

Additional Wnt16 Products

Bioinformatics Tool for Wnt16 Antibody (NBP1-86403)

Discover related pathways, diseases and genes to Wnt16 Antibody (NBP1-86403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt16 Antibody (NBP1-86403)

Discover more about diseases related to Wnt16 Antibody (NBP1-86403).
 

Pathways for Wnt16 Antibody (NBP1-86403)

View related products by pathway.

PTMs for Wnt16 Antibody (NBP1-86403)

Learn more about PTMs related to Wnt16 Antibody (NBP1-86403).
 

Research Areas for Wnt16 Antibody (NBP1-86403)

Find related products by research area.

Blogs on Wnt16

There are no specific blogs for Wnt16, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT16