Wnt16 Antibody - BSA Free

Immunohistochemistry-Paraffin: Wnt16 Antibody [NBP1-86403] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Wnt16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Wnt16 Antibody - BSA Free (NBP1-86403) is a polyclonal antibody validated for use in IHC. Anti-Wnt16 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNT16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Wnt16 Protein (NBP1-86403PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Wnt16 Antibody - BSA Free

• protein Wnt-16
• wingless-type MMTV integration site family, member 16

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. [provided by RefSeq]. Transcript Variant: This variant (2) differs from variant 1 at the 5' terminus including 5' UTR and the coding region for the N-terminus. It encodes a shorter isoform than variant 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Wnt16 Antibody (NBP1-86403)(1)

Publication using NBP1-86403

• Behrmann A, Zhong D, Li L, Xie S et Al. Wnt16 Promotes Vascular Smooth Muscle Contractile Phenotype and Function via Taz (Wwtr1) Activation in Male LDLR-/- Mice Endocrinology 2023-12-20 [PMID: 38123514]

FAQs for Wnt16 Antibody (NBP1-86403). (Showing 1 - 1 of 1 FAQ).

1. Do you think this would work for IHC in mouse tissue?
   • Unfortunately this antibody has only been validated in human samples; however the homology of the immunogen sequence to the mouse protein is 92%. If you are interested in trying this antibody in mouse samples our Innovator's Reward program can be of use to you.

Bioinformatics

• Gene Symbol: WNT16