Wnt-7b Antibody

Images

 
Western Blot: Wnt-7b Antibody [NBP1-59564] - Titration: 0.2-1 ug/ml, Positive Control: Human kidney.
Immunohistochemistry-Paraffin: Wnt-7b Antibody [NBP1-59564] - Human Brain, cortex tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, EqSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-7b Antibody Summary

Immunogen
Synthetic peptides corresponding to WNT7B(wingless-type MMTV integration site family, member 7B) The peptide sequence was selected from the middle region of WNT7B (NP_478679) Peptide sequence WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Porcine (100%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
Use in Immunohistochemistry-Frozen reported in scientific literature (PMID25823570)
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-59564 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29871934)..

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt-7b Antibody

  • protein Wnt-7b
  • wingless-type MMTV integration site family, member 7B
  • Wnt7b
  • Wnt-7b

Background

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF475
Species: Mu
Applications: WB, IHC
NBP2-46367
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-75713
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20913
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3464
Species: Hu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
7196-WN/CF
Species: Hu
3669-WN/CF
Species: Mu
6179-WN/CF
Species: Hu
AF4109
Species: Hu
Applications: WB, IHC
AF3157
Species: Hu
Applications: WB, IHC
AF3367
Species: Hu, Mu
Applications: WB
NBP1-76916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6646
Species: Hu
Applications: WB
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-59564
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-59564
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Wnt-7b Antibody (NBP1-59564)(4)

Reviews for Wnt-7b Antibody (NBP1-59564) (0)

There are no reviews for Wnt-7b Antibody (NBP1-59564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-7b Antibody (NBP1-59564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Wnt-7b Products

Bioinformatics Tool for Wnt-7b Antibody (NBP1-59564)

Discover related pathways, diseases and genes to Wnt-7b Antibody (NBP1-59564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-7b Antibody (NBP1-59564)

Discover more about diseases related to Wnt-7b Antibody (NBP1-59564).
 

Pathways for Wnt-7b Antibody (NBP1-59564)

View related products by pathway.

PTMs for Wnt-7b Antibody (NBP1-59564)

Learn more about PTMs related to Wnt-7b Antibody (NBP1-59564).
 

Research Areas for Wnt-7b Antibody (NBP1-59564)

Find related products by research area.

Blogs on Wnt-7b

There are no specific blogs for Wnt-7b, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-7b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT7B
Entrez
Uniprot