Wnt-6 Antibody


Western Blot: Wnt-6 Antibody [NBP1-62305] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Wnt-6 Antibody Summary

Synthetic peptides corresponding to WNT6(wingless-type MMTV integration site family, member 6) The peptide sequence was selected from the middle region of WNT6. Peptide sequence ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against WNT6 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt-6 Antibody

  • protein Wnt-6
  • wingless-type MMTV integration site family, member 6
  • Wnt6
  • Wnt-6


The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Mu
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB
Species: Hu
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Wnt-6 Antibody (NBP1-62305) (0)

There are no publications for Wnt-6 Antibody (NBP1-62305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-6 Antibody (NBP1-62305) (0)

There are no reviews for Wnt-6 Antibody (NBP1-62305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-6 Antibody (NBP1-62305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Wnt-6 Antibody (NBP1-62305)

Discover related pathways, diseases and genes to Wnt-6 Antibody (NBP1-62305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-6 Antibody (NBP1-62305)

Discover more about diseases related to Wnt-6 Antibody (NBP1-62305).

Pathways for Wnt-6 Antibody (NBP1-62305)

View related products by pathway.

PTMs for Wnt-6 Antibody (NBP1-62305)

Learn more about PTMs related to Wnt-6 Antibody (NBP1-62305).

Research Areas for Wnt-6 Antibody (NBP1-62305)

Find related products by research area.

Blogs on Wnt-6

There are no specific blogs for Wnt-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Wnt-6 Antibody and receive a gift card or discount.


Gene Symbol WNT6